Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 1896756..1897674 | Replicon | chromosome |
| Accession | NZ_CP098701 | ||
| Organism | Yersinia ruckeri strain NVI-5089 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | ND440_RS08515 | Protein ID | WP_265318566.1 |
| Coordinates | 1897216..1897674 (+) | Length | 153 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A085U7R3 |
| Locus tag | ND440_RS08510 | Protein ID | WP_038242631.1 |
| Coordinates | 1896756..1897202 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND440_RS08490 (ND440_08485) | 1892454..1893158 | + | 705 | WP_004717543.1 | murein tripeptide amidase MpaA | - |
| ND440_RS08495 (ND440_08490) | 1893169..1894143 | - | 975 | WP_071666721.1 | L-Ala-D/L-Glu epimerase | - |
| ND440_RS08500 (ND440_08495) | 1894293..1894796 | + | 504 | WP_004717547.1 | thiol peroxidase | - |
| ND440_RS08505 (ND440_08500) | 1894831..1896438 | - | 1608 | WP_038251390.1 | transcriptional regulator TyrR | - |
| ND440_RS08510 (ND440_08505) | 1896756..1897202 | + | 447 | WP_038242631.1 | DUF2384 domain-containing protein | Antitoxin |
| ND440_RS08515 (ND440_08510) | 1897216..1897674 | + | 459 | WP_265318566.1 | RES domain-containing protein | Toxin |
| ND440_RS08520 (ND440_08515) | 1897678..1898736 | - | 1059 | WP_248578616.1 | YcjF family protein | - |
| ND440_RS08525 (ND440_08520) | 1898733..1900130 | - | 1398 | WP_004717556.1 | YcjX family protein | - |
| ND440_RS08530 (ND440_08525) | 1900111..1900353 | - | 243 | WP_087931058.1 | phage shock protein PspD | - |
| ND440_RS08535 (ND440_08530) | 1900417..1900776 | - | 360 | WP_004717559.1 | envelope stress response membrane protein PspC | - |
| ND440_RS08540 (ND440_08535) | 1900776..1901003 | - | 228 | WP_248578617.1 | envelope stress response membrane protein PspB | - |
| ND440_RS08545 (ND440_08540) | 1901087..1901752 | - | 666 | WP_004717561.1 | phage shock protein PspA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17019.50 Da Isoelectric Point: 6.3201
>T247809 WP_265318566.1 NZ_CP098701:1897216-1897674 [Yersinia ruckeri]
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPTPVATMDIGTEWIGSVSSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPCLK
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPTPVATMDIGTEWIGSVSSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPCLK
Download Length: 459 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16406.87 Da Isoelectric Point: 8.0956
>AT247809 WP_038242631.1 NZ_CP098701:1896756-1897202 [Yersinia ruckeri]
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|