Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 937779..938402 | Replicon | chromosome |
Accession | NZ_CP098701 | ||
Organism | Yersinia ruckeri strain NVI-5089 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A085U5C4 |
Locus tag | ND440_RS04145 | Protein ID | WP_038243726.1 |
Coordinates | 937779..937982 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A085U5C5 |
Locus tag | ND440_RS04150 | Protein ID | WP_004718732.1 |
Coordinates | 938034..938402 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ND440_RS04120 (ND440_04120) | 933634..933972 | + | 339 | WP_007886947.1 | P-II family nitrogen regulator | - |
ND440_RS04125 (ND440_04125) | 934011..935300 | + | 1290 | WP_004718723.1 | ammonium transporter AmtB | - |
ND440_RS04130 (ND440_04130) | 935415..936278 | - | 864 | WP_004718726.1 | acyl-CoA thioesterase II | - |
ND440_RS04135 (ND440_04135) | 936656..936970 | - | 315 | WP_248577445.1 | MGMT family protein | - |
ND440_RS04145 (ND440_04145) | 937779..937982 | - | 204 | WP_038243726.1 | expression modulating protein YmoA | Toxin |
ND440_RS04150 (ND440_04150) | 938034..938402 | - | 369 | WP_004718732.1 | Hha toxicity modulator TomB | Antitoxin |
ND440_RS04155 (ND440_04155) | 939451..939612 | + | 162 | WP_004718735.1 | hypothetical protein | - |
ND440_RS04160 (ND440_04160) | 939731..939874 | - | 144 | WP_004718738.1 | type B 50S ribosomal protein L36 | - |
ND440_RS04165 (ND440_04165) | 939894..940148 | - | 255 | WP_038243728.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8037.27 Da Isoelectric Point: 6.4573
>T247808 WP_038243726.1 NZ_CP098701:c937982-937779 [Yersinia ruckeri]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPATVWQHVK
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPATVWQHVK
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14277.08 Da Isoelectric Point: 4.4225
>AT247808 WP_004718732.1 NZ_CP098701:c938402-938034 [Yersinia ruckeri]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYADEIDLCELVEEYL
DDTYTLFSSYGINDPDLRRWQKTKDRLFRLFSGEYLCALMKN
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYADEIDLCELVEEYL
DDTYTLFSSYGINDPDLRRWQKTKDRLFRLFSGEYLCALMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085U5C4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085U5C5 |