Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 698318..698987 | Replicon | chromosome |
| Accession | NZ_CP098701 | ||
| Organism | Yersinia ruckeri strain NVI-5089 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A380QS17 |
| Locus tag | ND440_RS03055 | Protein ID | WP_038241020.1 |
| Coordinates | 698565..698987 (+) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | ND440_RS03050 | Protein ID | WP_004719196.1 |
| Coordinates | 698318..698584 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND440_RS03035 (ND440_03035) | 695655..695911 | - | 257 | Protein_586 | HD domain-containing protein | - |
| ND440_RS03040 (ND440_03040) | 696228..696893 | + | 666 | WP_175537887.1 | hemolysin III family protein | - |
| ND440_RS03045 (ND440_03045) | 697032..698024 | - | 993 | WP_038241018.1 | tRNA-modifying protein YgfZ | - |
| ND440_RS03050 (ND440_03050) | 698318..698584 | + | 267 | WP_004719196.1 | FAD assembly factor SdhE | Antitoxin |
| ND440_RS03055 (ND440_03055) | 698565..698987 | + | 423 | WP_038241020.1 | protein YgfX | Toxin |
| ND440_RS03060 (ND440_03060) | 699135..699653 | - | 519 | WP_038241022.1 | flavodoxin FldB | - |
| ND440_RS03065 (ND440_03065) | 699761..700660 | + | 900 | WP_004719193.1 | site-specific tyrosine recombinase XerD | - |
| ND440_RS03070 (ND440_03070) | 700692..701408 | + | 717 | WP_038276201.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| ND440_RS03075 (ND440_03075) | 701415..703148 | + | 1734 | WP_038276198.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16451.41 Da Isoelectric Point: 11.1478
>T247807 WP_038241020.1 NZ_CP098701:698565-698987 [Yersinia ruckeri]
VAQWRCDLRVSWRTQLFSLLVHGVLVLLTLVVPWPDGFTPLWLILLTLVVFECIRSQKNITSRQGEIRLKAGNLLIWKWQ
EWTLVRPPWITRYGVLLSLQGAGSRRRKRIWLASDSMSEEKWRELCLILRHTFDSAAGRE
VAQWRCDLRVSWRTQLFSLLVHGVLVLLTLVVPWPDGFTPLWLILLTLVVFECIRSQKNITSRQGEIRLKAGNLLIWKWQ
EWTLVRPPWITRYGVLLSLQGAGSRRRKRIWLASDSMSEEKWRELCLILRHTFDSAAGRE
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|