Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ypjF-yeeU/CbtA-CbeA
Location 2812480..2813213 Replicon chromosome
Accession NZ_CP098697
Organism Yersinia ruckeri strain NVI-6614

Toxin (Protein)


Gene name ypjF Uniprot ID -
Locus tag ND449_RS12930 Protein ID WP_096823575.1
Coordinates 2812884..2813213 (+) Length 110 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag ND449_RS12925 Protein ID WP_096823574.1
Coordinates 2812480..2812845 (+) Length 122 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ND449_RS12880 (ND449_12865) 2807775..2808476 + 702 WP_050297207.1 WYL domain-containing protein -
ND449_RS12885 (ND449_12870) 2808482..2809048 + 567 WP_096823569.1 hypothetical protein -
ND449_RS12890 (ND449_12875) 2809087..2809539 + 453 WP_096823570.1 hypothetical protein -
ND449_RS12895 (ND449_12880) 2809536..2809974 + 439 Protein_2499 IrmA family protein -
ND449_RS12900 (ND449_12885) 2810047..2810313 + 267 Protein_2500 DUF905 family protein -
ND449_RS12905 (ND449_12890) 2810386..2811207 + 822 WP_096823571.1 DUF932 domain-containing protein -
ND449_RS12910 (ND449_12895) 2811238..2811681 + 444 WP_096823572.1 antirestriction protein -
ND449_RS12915 (ND449_12900) 2811694..2812236 + 543 WP_096823573.1 DNA repair protein RadC -
ND449_RS12920 (ND449_12905) 2812233..2812454 + 222 WP_069325310.1 DUF987 domain-containing protein -
ND449_RS12925 (ND449_12910) 2812480..2812845 + 366 WP_096823574.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
ND449_RS12930 (ND449_12915) 2812884..2813213 + 330 WP_096823575.1 TA system toxin CbtA family protein Toxin
ND449_RS12935 (ND449_12920) 2813609..2814538 + 930 Protein_2507 integrase arm-type DNA-binding domain-containing protein -
ND449_RS12940 (ND449_12925) 2814784..2815338 + 555 WP_096823577.1 DUF4942 domain-containing protein -
ND449_RS12945 (ND449_12930) 2815447..2815770 + 324 WP_038277221.1 type II toxin-antitoxin system RelE/ParE family toxin -
ND449_RS12950 (ND449_12935) 2815757..2816038 + 282 WP_038277219.1 helix-turn-helix transcriptional regulator -
ND449_RS12955 (ND449_12940) 2816247..2817787 - 1541 Protein_2511 IS3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2812480..2825582 13102
- flank IS/Tn - - 2817991..2818257 266


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-108)

Antitoxin

Antitoxin CbeA

(17-117)


Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12376.18 Da        Isoelectric Point: 8.0799

>T247802 WP_096823575.1 NZ_CP098697:2812884-2813213 [Yersinia ruckeri]
MQTLSSHPTRASQPCLSPVEIWQLLLTHLLSQHYGLTLNDTPFINETTIREHIDAGVSLSDAVNFLVEKYGLVRIDRKGF
SWQEQTPYISVVDILRARRSTGLLKTNVK

Download         Length: 330 bp

Antitoxin


Download         Length: 122 a.a.        Molecular weight: 13414.09 Da        Isoelectric Point: 5.4157

>AT247802 WP_096823574.1 NZ_CP098697:2812480-2812845 [Yersinia ruckeri]
MNNHSESVTKPENPACQQWGLKSTITPCFGARLVLEGNRLHFLADRAGFNGAFSDDDALHLDHAFPLILKQLELMLTSGE
LSPRHQHCVTLYHNGLTCEADTLGSCGYVYIAIYPDQTEPQ

Download         Length: 366 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References