Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 954580..955203 | Replicon | chromosome |
Accession | NZ_CP098697 | ||
Organism | Yersinia ruckeri strain NVI-6614 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A085U5C4 |
Locus tag | ND449_RS04330 | Protein ID | WP_038243726.1 |
Coordinates | 954580..954783 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A085U5C5 |
Locus tag | ND449_RS04335 | Protein ID | WP_004718732.1 |
Coordinates | 954835..955203 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ND449_RS04305 (ND449_04300) | 950435..950773 | + | 339 | WP_007886947.1 | P-II family nitrogen regulator | - |
ND449_RS04310 (ND449_04305) | 950812..952101 | + | 1290 | WP_004718723.1 | ammonium transporter AmtB | - |
ND449_RS04315 (ND449_04310) | 952216..953079 | - | 864 | WP_004718726.1 | acyl-CoA thioesterase II | - |
ND449_RS04320 (ND449_04315) | 953457..953771 | - | 315 | WP_004718728.1 | MGMT family protein | - |
ND449_RS04330 (ND449_04325) | 954580..954783 | - | 204 | WP_038243726.1 | expression modulating protein YmoA | Toxin |
ND449_RS04335 (ND449_04330) | 954835..955203 | - | 369 | WP_004718732.1 | Hha toxicity modulator TomB | Antitoxin |
ND449_RS04340 (ND449_04335) | 956276..956413 | + | 138 | WP_155274690.1 | hypothetical protein | - |
ND449_RS04345 (ND449_04340) | 956532..956675 | - | 144 | WP_004718738.1 | type B 50S ribosomal protein L36 | - |
ND449_RS04350 (ND449_04345) | 956695..956949 | - | 255 | WP_038243728.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8037.27 Da Isoelectric Point: 6.4573
>T247796 WP_038243726.1 NZ_CP098697:c954783-954580 [Yersinia ruckeri]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPATVWQHVK
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPATVWQHVK
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14277.08 Da Isoelectric Point: 4.4225
>AT247796 WP_004718732.1 NZ_CP098697:c955203-954835 [Yersinia ruckeri]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYADEIDLCELVEEYL
DDTYTLFSSYGINDPDLRRWQKTKDRLFRLFSGEYLCALMKN
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYADEIDLCELVEEYL
DDTYTLFSSYGINDPDLRRWQKTKDRLFRLFSGEYLCALMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085U5C4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085U5C5 |