Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2998619..2999288 | Replicon | chromosome |
Accession | NZ_CP098695 | ||
Organism | Yersinia ruckeri strain NVI-701 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A380QS17 |
Locus tag | ND443_RS13730 | Protein ID | WP_038241020.1 |
Coordinates | 2998619..2999041 (-) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | ND443_RS13735 | Protein ID | WP_004719196.1 |
Coordinates | 2999022..2999288 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ND443_RS13710 (ND443_13695) | 2994458..2996191 | - | 1734 | WP_038276198.1 | single-stranded-DNA-specific exonuclease RecJ | - |
ND443_RS13715 (ND443_13700) | 2996198..2996914 | - | 717 | WP_004719192.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
ND443_RS13720 (ND443_13705) | 2996946..2997845 | - | 900 | WP_004719193.1 | site-specific tyrosine recombinase XerD | - |
ND443_RS13725 (ND443_13710) | 2997953..2998471 | + | 519 | WP_038241022.1 | flavodoxin FldB | - |
ND443_RS13730 (ND443_13715) | 2998619..2999041 | - | 423 | WP_038241020.1 | protein YgfX | Toxin |
ND443_RS13735 (ND443_13720) | 2999022..2999288 | - | 267 | WP_004719196.1 | FAD assembly factor SdhE | Antitoxin |
ND443_RS13740 (ND443_13725) | 2999582..3000574 | + | 993 | WP_096823598.1 | tRNA-modifying protein YgfZ | - |
ND443_RS13745 (ND443_13730) | 3000713..3001378 | - | 666 | WP_175537887.1 | hemolysin III family protein | - |
ND443_RS13750 (ND443_13735) | 3001695..3001951 | + | 257 | Protein_2667 | HD domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16451.41 Da Isoelectric Point: 11.1478
>T247792 WP_038241020.1 NZ_CP098695:c2999041-2998619 [Yersinia ruckeri]
VAQWRCDLRVSWRTQLFSLLVHGVLVLLTLVVPWPDGFTPLWLILLTLVVFECIRSQKNITSRQGEIRLKAGNLLIWKWQ
EWTLVRPPWITRYGVLLSLQGAGSRRRKRIWLASDSMSEEKWRELCLILRHTFDSAAGRE
VAQWRCDLRVSWRTQLFSLLVHGVLVLLTLVVPWPDGFTPLWLILLTLVVFECIRSQKNITSRQGEIRLKAGNLLIWKWQ
EWTLVRPPWITRYGVLLSLQGAGSRRRKRIWLASDSMSEEKWRELCLILRHTFDSAAGRE
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|