Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ypjF-yeeU/CbtA-CbeA
Location 2803886..2804619 Replicon chromosome
Accession NZ_CP098695
Organism Yersinia ruckeri strain NVI-701

Toxin (Protein)


Gene name ypjF Uniprot ID -
Locus tag ND443_RS12865 Protein ID WP_096823575.1
Coordinates 2804290..2804619 (+) Length 110 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag ND443_RS12860 Protein ID WP_096823574.1
Coordinates 2803886..2804251 (+) Length 122 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ND443_RS12815 (ND443_12800) 2799181..2799882 + 702 WP_050297207.1 WYL domain-containing protein -
ND443_RS12820 (ND443_12805) 2799888..2800454 + 567 WP_096823569.1 hypothetical protein -
ND443_RS12825 (ND443_12810) 2800493..2800945 + 453 WP_096823570.1 hypothetical protein -
ND443_RS12830 (ND443_12815) 2800942..2801380 + 439 Protein_2491 IrmA family protein -
ND443_RS12835 (ND443_12820) 2801453..2801719 + 267 Protein_2492 DUF905 family protein -
ND443_RS12840 (ND443_12825) 2801792..2802613 + 822 WP_096823571.1 DUF932 domain-containing protein -
ND443_RS12845 (ND443_12830) 2802644..2803087 + 444 WP_096823572.1 antirestriction protein -
ND443_RS12850 (ND443_12835) 2803100..2803642 + 543 WP_096823573.1 DNA repair protein RadC -
ND443_RS12855 (ND443_12840) 2803639..2803860 + 222 WP_069325310.1 DUF987 domain-containing protein -
ND443_RS12860 (ND443_12845) 2803886..2804251 + 366 WP_096823574.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
ND443_RS12865 (ND443_12850) 2804290..2804619 + 330 WP_096823575.1 TA system toxin CbtA family protein Toxin
ND443_RS12870 (ND443_12855) 2805015..2805944 + 930 Protein_2499 integrase arm-type DNA-binding domain-containing protein -
ND443_RS12875 (ND443_12860) 2806190..2806744 + 555 WP_096823577.1 DUF4942 domain-containing protein -
ND443_RS12880 (ND443_12865) 2806853..2807176 + 324 WP_038277221.1 type II toxin-antitoxin system RelE/ParE family toxin -
ND443_RS12885 (ND443_12870) 2807163..2807444 + 282 WP_038277219.1 helix-turn-helix transcriptional regulator -
ND443_RS12890 (ND443_12875) 2807653..2809193 - 1541 Protein_2503 IS3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2809397..2809663 266


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-108)

Antitoxin

Antitoxin CbeA

(17-117)


Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12376.18 Da        Isoelectric Point: 8.0799

>T247791 WP_096823575.1 NZ_CP098695:2804290-2804619 [Yersinia ruckeri]
MQTLSSHPTRASQPCLSPVEIWQLLLTHLLSQHYGLTLNDTPFINETTIREHIDAGVSLSDAVNFLVEKYGLVRIDRKGF
SWQEQTPYISVVDILRARRSTGLLKTNVK

Download         Length: 330 bp

Antitoxin


Download         Length: 122 a.a.        Molecular weight: 13414.09 Da        Isoelectric Point: 5.4157

>AT247791 WP_096823574.1 NZ_CP098695:2803886-2804251 [Yersinia ruckeri]
MNNHSESVTKPENPACQQWGLKSTITPCFGARLVLEGNRLHFLADRAGFNGAFSDDDALHLDHAFPLILKQLELMLTSGE
LSPRHQHCVTLYHNGLTCEADTLGSCGYVYIAIYPDQTEPQ

Download         Length: 366 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References