Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ypjF-yeeU/CbtA-CbeA |
| Location | 2803886..2804619 | Replicon | chromosome |
| Accession | NZ_CP098695 | ||
| Organism | Yersinia ruckeri strain NVI-701 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | - |
| Locus tag | ND443_RS12865 | Protein ID | WP_096823575.1 |
| Coordinates | 2804290..2804619 (+) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | ND443_RS12860 | Protein ID | WP_096823574.1 |
| Coordinates | 2803886..2804251 (+) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND443_RS12815 (ND443_12800) | 2799181..2799882 | + | 702 | WP_050297207.1 | WYL domain-containing protein | - |
| ND443_RS12820 (ND443_12805) | 2799888..2800454 | + | 567 | WP_096823569.1 | hypothetical protein | - |
| ND443_RS12825 (ND443_12810) | 2800493..2800945 | + | 453 | WP_096823570.1 | hypothetical protein | - |
| ND443_RS12830 (ND443_12815) | 2800942..2801380 | + | 439 | Protein_2491 | IrmA family protein | - |
| ND443_RS12835 (ND443_12820) | 2801453..2801719 | + | 267 | Protein_2492 | DUF905 family protein | - |
| ND443_RS12840 (ND443_12825) | 2801792..2802613 | + | 822 | WP_096823571.1 | DUF932 domain-containing protein | - |
| ND443_RS12845 (ND443_12830) | 2802644..2803087 | + | 444 | WP_096823572.1 | antirestriction protein | - |
| ND443_RS12850 (ND443_12835) | 2803100..2803642 | + | 543 | WP_096823573.1 | DNA repair protein RadC | - |
| ND443_RS12855 (ND443_12840) | 2803639..2803860 | + | 222 | WP_069325310.1 | DUF987 domain-containing protein | - |
| ND443_RS12860 (ND443_12845) | 2803886..2804251 | + | 366 | WP_096823574.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| ND443_RS12865 (ND443_12850) | 2804290..2804619 | + | 330 | WP_096823575.1 | TA system toxin CbtA family protein | Toxin |
| ND443_RS12870 (ND443_12855) | 2805015..2805944 | + | 930 | Protein_2499 | integrase arm-type DNA-binding domain-containing protein | - |
| ND443_RS12875 (ND443_12860) | 2806190..2806744 | + | 555 | WP_096823577.1 | DUF4942 domain-containing protein | - |
| ND443_RS12880 (ND443_12865) | 2806853..2807176 | + | 324 | WP_038277221.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| ND443_RS12885 (ND443_12870) | 2807163..2807444 | + | 282 | WP_038277219.1 | helix-turn-helix transcriptional regulator | - |
| ND443_RS12890 (ND443_12875) | 2807653..2809193 | - | 1541 | Protein_2503 | IS3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2809397..2809663 | 266 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12376.18 Da Isoelectric Point: 8.0799
>T247791 WP_096823575.1 NZ_CP098695:2804290-2804619 [Yersinia ruckeri]
MQTLSSHPTRASQPCLSPVEIWQLLLTHLLSQHYGLTLNDTPFINETTIREHIDAGVSLSDAVNFLVEKYGLVRIDRKGF
SWQEQTPYISVVDILRARRSTGLLKTNVK
MQTLSSHPTRASQPCLSPVEIWQLLLTHLLSQHYGLTLNDTPFINETTIREHIDAGVSLSDAVNFLVEKYGLVRIDRKGF
SWQEQTPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13414.09 Da Isoelectric Point: 5.4157
>AT247791 WP_096823574.1 NZ_CP098695:2803886-2804251 [Yersinia ruckeri]
MNNHSESVTKPENPACQQWGLKSTITPCFGARLVLEGNRLHFLADRAGFNGAFSDDDALHLDHAFPLILKQLELMLTSGE
LSPRHQHCVTLYHNGLTCEADTLGSCGYVYIAIYPDQTEPQ
MNNHSESVTKPENPACQQWGLKSTITPCFGARLVLEGNRLHFLADRAGFNGAFSDDDALHLDHAFPLILKQLELMLTSGE
LSPRHQHCVTLYHNGLTCEADTLGSCGYVYIAIYPDQTEPQ
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|