Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 1877210..1878128 | Replicon | chromosome |
| Accession | NZ_CP098695 | ||
| Organism | Yersinia ruckeri strain NVI-701 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | ND443_RS08400 | Protein ID | WP_038242633.1 |
| Coordinates | 1877670..1878128 (+) | Length | 153 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A085U7R3 |
| Locus tag | ND443_RS08395 | Protein ID | WP_038242631.1 |
| Coordinates | 1877210..1877656 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND443_RS08375 (ND443_08360) | 1872908..1873612 | + | 705 | WP_004717543.1 | murein tripeptide amidase MpaA | - |
| ND443_RS08380 (ND443_08365) | 1873623..1874597 | - | 975 | WP_071706618.1 | L-Ala-D/L-Glu epimerase | - |
| ND443_RS08385 (ND443_08370) | 1874747..1875250 | + | 504 | WP_004717547.1 | thiol peroxidase | - |
| ND443_RS08390 (ND443_08375) | 1875285..1876892 | - | 1608 | WP_096823414.1 | transcriptional regulator TyrR | - |
| ND443_RS08395 (ND443_08380) | 1877210..1877656 | + | 447 | WP_038242631.1 | DUF2384 domain-containing protein | Antitoxin |
| ND443_RS08400 (ND443_08385) | 1877670..1878128 | + | 459 | WP_038242633.1 | RES domain-containing protein | Toxin |
| ND443_RS08405 (ND443_08390) | 1878132..1879190 | - | 1059 | WP_038242635.1 | YcjF family protein | - |
| ND443_RS08410 (ND443_08395) | 1879187..1880584 | - | 1398 | WP_004717556.1 | YcjX family protein | - |
| ND443_RS08415 (ND443_08400) | 1880565..1880807 | - | 243 | WP_096823415.1 | phage shock protein PspD | - |
| ND443_RS08420 (ND443_08405) | 1880871..1881230 | - | 360 | WP_004717559.1 | envelope stress response membrane protein PspC | - |
| ND443_RS08425 (ND443_08410) | 1881230..1881457 | - | 228 | WP_038242637.1 | envelope stress response membrane protein PspB | - |
| ND443_RS08430 (ND443_08415) | 1881541..1882206 | - | 666 | WP_038275968.1 | phage shock protein PspA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17072.55 Da Isoelectric Point: 6.6384
>T247786 WP_038242633.1 NZ_CP098695:1877670-1878128 [Yersinia ruckeri]
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPTPVATMDIGTEWIGSVSSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPRLK
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPTPVATMDIGTEWIGSVSSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSINPLTFSFDPRLK
Download Length: 459 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16406.87 Da Isoelectric Point: 8.0956
>AT247786 WP_038242631.1 NZ_CP098695:1877210-1877656 [Yersinia ruckeri]
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|