247782

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 3128744..3129278 Replicon chromosome
Accession NZ_CP098694
Organism Yersinia ruckeri strain NVI-8270

Toxin (Protein)


Gene name relE Uniprot ID A0A0T9LYG3
Locus tag ND446_RS14125 Protein ID WP_038275268.1
Coordinates 3128744..3129034 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A1JJ37
Locus tag ND446_RS14130 Protein ID WP_005175264.1
Coordinates 3129024..3129278 (-) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ND446_RS14075 (ND446_14065) 3124020..3124250 - 231 Protein_2723 DUF4942 domain-containing protein -
ND446_RS14080 (ND446_14070) 3124400..3124528 + 129 Protein_2724 helix-turn-helix domain-containing protein -
ND446_RS14085 (ND446_14075) 3124521..3124641 + 121 Protein_2725 transposase -
ND446_RS14090 (ND446_14080) 3124670..3124966 - 297 Protein_2726 integrase core domain-containing protein -
ND446_RS14095 (ND446_14085) 3124965..3125363 + 399 Protein_2727 integrase core domain-containing protein -
ND446_RS14100 (ND446_14090) 3125382..3125648 - 267 Protein_2728 hypothetical protein -
ND446_RS14105 (ND446_14095) 3125669..3126736 - 1068 WP_096823272.1 macro domain-containing protein -
ND446_RS14110 (ND446_14100) 3126733..3127389 - 657 WP_096823271.1 DUF4433 domain-containing protein -
ND446_RS14115 (ND446_14105) 3127392..3127967 - 576 WP_234049239.1 DarT ssDNA thymidine ADP-ribosyltransferase family protein -
ND446_RS14120 (ND446_14110) 3128091..3128480 - 390 WP_234056964.1 restriction endonuclease subunit S -
ND446_RS14125 (ND446_14115) 3128744..3129034 - 291 WP_038275268.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ND446_RS14130 (ND446_14120) 3129024..3129278 - 255 WP_005175264.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
ND446_RS14135 (ND446_14125) 3129452..3129826 - 375 Protein_2735 tyrosine-type recombinase/integrase -
ND446_RS14140 (ND446_14130) 3129916..3131066 + 1151 WP_087931031.1 IS3 family transposase -
ND446_RS14145 (ND446_14135) 3131084..3131407 - 324 Protein_2737 Arm DNA-binding domain-containing protein -
ND446_RS14155 (ND446_14145) 3131793..3132863 - 1071 WP_038241732.1 LPS export ABC transporter permease LptG -
ND446_RS14160 (ND446_14150) 3132863..3133957 - 1095 WP_234056962.1 LPS export ABC transporter permease LptF -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3124670..3144722 20052
- inside IScluster/Tn - - 3124670..3131066 6396


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-84)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-75)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11494.42 Da        Isoelectric Point: 9.9816

>T247782 WP_038275268.1 NZ_CP098694:c3129034-3128744 [Yersinia ruckeri]
MTFNIDFDERALKEWHKLDKTIREQFKKKLRKLQENPYIESARLHGDLAGCFKIKLRASGFRLIYQVIDEEIVIWIVAVG
KREDEKAYDIAKKRIQ

Download         Length: 291 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9680.07 Da        Isoelectric Point: 4.8283

>AT247782 WP_005175264.1 NZ_CP098694:c3129278-3129024 [Yersinia ruckeri]
MSTIQIRVDDELKKSAYQAFEKLNLSPSDALRLFLRYVAENEKLPFSEVSVMVSNQDEDADILAVVRERLKNPAKRIRVN
IDDL

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0T9LYG3

Antitoxin

Source ID Structure
AlphaFold DB A1JJ37

References