Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 3128744..3129278 | Replicon | chromosome |
| Accession | NZ_CP098694 | ||
| Organism | Yersinia ruckeri strain NVI-8270 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A0T9LYG3 |
| Locus tag | ND446_RS14125 | Protein ID | WP_038275268.1 |
| Coordinates | 3128744..3129034 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A1JJ37 |
| Locus tag | ND446_RS14130 | Protein ID | WP_005175264.1 |
| Coordinates | 3129024..3129278 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND446_RS14075 (ND446_14065) | 3124020..3124250 | - | 231 | Protein_2723 | DUF4942 domain-containing protein | - |
| ND446_RS14080 (ND446_14070) | 3124400..3124528 | + | 129 | Protein_2724 | helix-turn-helix domain-containing protein | - |
| ND446_RS14085 (ND446_14075) | 3124521..3124641 | + | 121 | Protein_2725 | transposase | - |
| ND446_RS14090 (ND446_14080) | 3124670..3124966 | - | 297 | Protein_2726 | integrase core domain-containing protein | - |
| ND446_RS14095 (ND446_14085) | 3124965..3125363 | + | 399 | Protein_2727 | integrase core domain-containing protein | - |
| ND446_RS14100 (ND446_14090) | 3125382..3125648 | - | 267 | Protein_2728 | hypothetical protein | - |
| ND446_RS14105 (ND446_14095) | 3125669..3126736 | - | 1068 | WP_096823272.1 | macro domain-containing protein | - |
| ND446_RS14110 (ND446_14100) | 3126733..3127389 | - | 657 | WP_096823271.1 | DUF4433 domain-containing protein | - |
| ND446_RS14115 (ND446_14105) | 3127392..3127967 | - | 576 | WP_234049239.1 | DarT ssDNA thymidine ADP-ribosyltransferase family protein | - |
| ND446_RS14120 (ND446_14110) | 3128091..3128480 | - | 390 | WP_234056964.1 | restriction endonuclease subunit S | - |
| ND446_RS14125 (ND446_14115) | 3128744..3129034 | - | 291 | WP_038275268.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ND446_RS14130 (ND446_14120) | 3129024..3129278 | - | 255 | WP_005175264.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| ND446_RS14135 (ND446_14125) | 3129452..3129826 | - | 375 | Protein_2735 | tyrosine-type recombinase/integrase | - |
| ND446_RS14140 (ND446_14130) | 3129916..3131066 | + | 1151 | WP_087931031.1 | IS3 family transposase | - |
| ND446_RS14145 (ND446_14135) | 3131084..3131407 | - | 324 | Protein_2737 | Arm DNA-binding domain-containing protein | - |
| ND446_RS14155 (ND446_14145) | 3131793..3132863 | - | 1071 | WP_038241732.1 | LPS export ABC transporter permease LptG | - |
| ND446_RS14160 (ND446_14150) | 3132863..3133957 | - | 1095 | WP_234056962.1 | LPS export ABC transporter permease LptF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3124670..3144722 | 20052 | |
| - | inside | IScluster/Tn | - | - | 3124670..3131066 | 6396 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11494.42 Da Isoelectric Point: 9.9816
>T247782 WP_038275268.1 NZ_CP098694:c3129034-3128744 [Yersinia ruckeri]
MTFNIDFDERALKEWHKLDKTIREQFKKKLRKLQENPYIESARLHGDLAGCFKIKLRASGFRLIYQVIDEEIVIWIVAVG
KREDEKAYDIAKKRIQ
MTFNIDFDERALKEWHKLDKTIREQFKKKLRKLQENPYIESARLHGDLAGCFKIKLRASGFRLIYQVIDEEIVIWIVAVG
KREDEKAYDIAKKRIQ
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0T9LYG3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A1JJ37 |