Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 2634569..2635192 | Replicon | chromosome |
| Accession | NZ_CP098694 | ||
| Organism | Yersinia ruckeri strain NVI-8270 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A085U5C4 |
| Locus tag | ND446_RS11935 | Protein ID | WP_038243726.1 |
| Coordinates | 2634989..2635192 (+) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A085U5C5 |
| Locus tag | ND446_RS11930 | Protein ID | WP_004718732.1 |
| Coordinates | 2634569..2634937 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND446_RS11915 (ND446_11915) | 2632822..2633076 | + | 255 | WP_038243728.1 | type B 50S ribosomal protein L31 | - |
| ND446_RS11920 (ND446_11920) | 2633096..2633239 | + | 144 | WP_004718738.1 | type B 50S ribosomal protein L36 | - |
| ND446_RS11925 (ND446_11925) | 2633358..2633495 | - | 138 | WP_186368427.1 | hypothetical protein | - |
| ND446_RS11930 (ND446_11930) | 2634569..2634937 | + | 369 | WP_004718732.1 | Hha toxicity modulator TomB | Antitoxin |
| ND446_RS11935 (ND446_11935) | 2634989..2635192 | + | 204 | WP_038243726.1 | expression modulating protein YmoA | Toxin |
| ND446_RS11945 (ND446_11945) | 2636001..2636315 | + | 315 | WP_004718728.1 | MGMT family protein | - |
| ND446_RS11950 (ND446_11950) | 2636693..2637556 | + | 864 | WP_004718726.1 | acyl-CoA thioesterase II | - |
| ND446_RS11955 (ND446_11955) | 2637671..2638960 | - | 1290 | WP_234055581.1 | ammonium transporter AmtB | - |
| ND446_RS11960 (ND446_11960) | 2638999..2639337 | - | 339 | WP_007886947.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8037.27 Da Isoelectric Point: 6.4573
>T247779 WP_038243726.1 NZ_CP098694:2634989-2635192 [Yersinia ruckeri]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPATVWQHVK
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPATVWQHVK
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14277.08 Da Isoelectric Point: 4.4225
>AT247779 WP_004718732.1 NZ_CP098694:2634569-2634937 [Yersinia ruckeri]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYADEIDLCELVEEYL
DDTYTLFSSYGINDPDLRRWQKTKDRLFRLFSGEYLCALMKN
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYADEIDLCELVEEYL
DDTYTLFSSYGINDPDLRRWQKTKDRLFRLFSGEYLCALMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A085U5C4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A085U5C5 |