Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 1703364..1704282 | Replicon | chromosome |
| Accession | NZ_CP098694 | ||
| Organism | Yersinia ruckeri strain NVI-8270 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | ND446_RS07835 | Protein ID | WP_234056461.1 |
| Coordinates | 1703364..1703822 (-) | Length | 153 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A085U7R3 |
| Locus tag | ND446_RS07840 | Protein ID | WP_038242631.1 |
| Coordinates | 1703836..1704282 (-) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND446_RS07805 (ND446_07805) | 1699286..1699951 | + | 666 | WP_145497062.1 | phage shock protein PspA | - |
| ND446_RS07810 (ND446_07810) | 1700035..1700262 | + | 228 | WP_038242637.1 | envelope stress response membrane protein PspB | - |
| ND446_RS07815 (ND446_07815) | 1700262..1700621 | + | 360 | WP_004717559.1 | envelope stress response membrane protein PspC | - |
| ND446_RS07820 (ND446_07820) | 1700784..1700927 | + | 144 | WP_234049335.1 | phage shock protein PspD | - |
| ND446_RS07825 (ND446_07825) | 1700908..1702305 | + | 1398 | WP_004717556.1 | YcjX family protein | - |
| ND446_RS07830 (ND446_07830) | 1702302..1703360 | + | 1059 | WP_038242635.1 | YcjF family protein | - |
| ND446_RS07835 (ND446_07835) | 1703364..1703822 | - | 459 | WP_234056461.1 | RES domain-containing protein | Toxin |
| ND446_RS07840 (ND446_07840) | 1703836..1704282 | - | 447 | WP_038242631.1 | DUF2384 domain-containing protein | Antitoxin |
| ND446_RS07845 (ND446_07845) | 1704600..1706207 | + | 1608 | WP_038251390.1 | transcriptional regulator TyrR | - |
| ND446_RS07850 (ND446_07850) | 1706242..1706745 | - | 504 | WP_004717547.1 | thiol peroxidase | - |
| ND446_RS07855 (ND446_07855) | 1706895..1707869 | + | 975 | WP_234056460.1 | L-Ala-D/L-Glu epimerase | - |
| ND446_RS07860 (ND446_07860) | 1707880..1708584 | - | 705 | WP_004717543.1 | murein tripeptide amidase MpaA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17067.54 Da Isoelectric Point: 6.7537
>T247778 WP_234056461.1 NZ_CP098694:c1703822-1703364 [Yersinia ruckeri]
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPTPVATMDIGTEWIGSASSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSIHPLTFSFDPRLK
VMLYRIVHNRYLATAWTGYGAETYGGRWNHKGHAAIYLASSVSLAMLETLVHVEDSATLNDFNLFQITIPDNAIMVLQQQ
DWPRGWRDDPTPVATMDIGTEWIGSASSVGLLVPSTLVPLERNMLVNPKHRDFASCLKSIHPLTFSFDPRLK
Download Length: 459 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16406.87 Da Isoelectric Point: 8.0956
>AT247778 WP_038242631.1 NZ_CP098694:c1704282-1703836 [Yersinia ruckeri]
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
MRTYHPSPMAKVSALWREIGLPASRGTALVDSIKLGFTVDVIDTIHLWADMPKSEILRATGIPSRSLTRRRTHDGRFTPE
ESERIARFVRVMDAAVDLFGGDRTKATAWMSMPVKGLGNRTPDSLLETETGALEICDLIGRLEHGVFS
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|