Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 740478..741147 | Replicon | chromosome |
Accession | NZ_CP098694 | ||
Organism | Yersinia ruckeri strain NVI-8270 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A380QS17 |
Locus tag | ND446_RS03365 | Protein ID | WP_038241020.1 |
Coordinates | 740725..741147 (+) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | ND446_RS03360 | Protein ID | WP_004719196.1 |
Coordinates | 740478..740744 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ND446_RS03345 (ND446_03345) | 737815..738071 | - | 257 | Protein_647 | HD domain-containing protein | - |
ND446_RS03350 (ND446_03350) | 738388..739053 | + | 666 | WP_175537887.1 | hemolysin III family protein | - |
ND446_RS03355 (ND446_03355) | 739192..740184 | - | 993 | WP_038241018.1 | tRNA-modifying protein YgfZ | - |
ND446_RS03360 (ND446_03360) | 740478..740744 | + | 267 | WP_004719196.1 | FAD assembly factor SdhE | Antitoxin |
ND446_RS03365 (ND446_03365) | 740725..741147 | + | 423 | WP_038241020.1 | protein YgfX | Toxin |
ND446_RS03370 (ND446_03370) | 741295..741813 | - | 519 | WP_038241022.1 | flavodoxin FldB | - |
ND446_RS03375 (ND446_03375) | 741921..742820 | + | 900 | WP_004719193.1 | site-specific tyrosine recombinase XerD | - |
ND446_RS03380 (ND446_03380) | 742852..743568 | + | 717 | WP_004719192.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
ND446_RS03385 (ND446_03385) | 743575..745308 | + | 1734 | WP_038276198.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16451.41 Da Isoelectric Point: 11.1478
>T247773 WP_038241020.1 NZ_CP098694:740725-741147 [Yersinia ruckeri]
VAQWRCDLRVSWRTQLFSLLVHGVLVLLTLVVPWPDGFTPLWLILLTLVVFECIRSQKNITSRQGEIRLKAGNLLIWKWQ
EWTLVRPPWITRYGVLLSLQGAGSRRRKRIWLASDSMSEEKWRELCLILRHTFDSAAGRE
VAQWRCDLRVSWRTQLFSLLVHGVLVLLTLVVPWPDGFTPLWLILLTLVVFECIRSQKNITSRQGEIRLKAGNLLIWKWQ
EWTLVRPPWITRYGVLLSLQGAGSRRRKRIWLASDSMSEEKWRELCLILRHTFDSAAGRE
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|