Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-RelB
Location 1237037..1237535 Replicon chromosome
Accession NZ_CP098690
Organism Rickettsia rickettsii strain Sao Paulo

Toxin (Protein)


Gene name relE Uniprot ID A0A0H3AWA1
Locus tag NDY48_RS06900 Protein ID WP_012151451.1
Coordinates 1237392..1237535 (+) Length 48 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID H8LNX5
Locus tag NDY48_RS06895 Protein ID WP_012151450.1
Coordinates 1237037..1237300 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NDY48_RS06850 (NDY48_06850) 1232282..1232398 + 117 WP_080508248.1 palindromic element RPE1 domain-containing protein -
NDY48_RS06855 (NDY48_06855) 1232450..1233145 - 696 WP_012151442.1 TIGR02281 family clan AA aspartic protease -
NDY48_RS06860 (NDY48_06860) 1233206..1233424 - 219 WP_012151443.1 serine hydrolase -
NDY48_RS06865 (NDY48_06865) 1233449..1233640 - 192 WP_012262643.1 hypothetical protein -
NDY48_RS06870 (NDY48_06870) 1233990..1234151 - 162 WP_012262644.1 serine hydrolase -
NDY48_RS06875 (NDY48_06875) 1234347..1234586 - 240 WP_012151447.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
NDY48_RS06880 (NDY48_06880) 1234791..1235513 - 723 WP_010977895.1 amino acid ABC transporter ATP-binding protein -
NDY48_RS06885 (NDY48_06885) 1235517..1236281 - 765 WP_012151448.1 MBL fold metallo-hydrolase -
NDY48_RS06890 (NDY48_06890) 1236296..1236943 + 648 WP_012151449.1 phosphatase PAP2 family protein -
NDY48_RS06895 (NDY48_06895) 1237037..1237300 + 264 WP_012151450.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
NDY48_RS06900 (NDY48_06900) 1237392..1237535 + 144 WP_012151451.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
NDY48_RS06905 (NDY48_06905) 1237671..1238753 + 1083 WP_014362438.1 LptF/LptG family permease -
NDY48_RS06910 (NDY48_06910) 1238759..1239223 - 465 WP_012151453.1 DNA polymerase III subunit chi -
NDY48_RS06920 (NDY48_06920) 1239423..1240568 - 1146 WP_012151455.1 succinyl-diaminopimelate desuccinylase -
NDY48_RS06925 (NDY48_06925) 1240572..1240826 - 255 WP_012151456.1 restriction endonuclease subunit S -
NDY48_RS06930 (NDY48_06930) 1241130..1241258 - 129 WP_230453655.1 hypothetical protein -
NDY48_RS06935 (NDY48_06935) 1241326..1241517 - 192 WP_014362439.1 hypothetical protein -
NDY48_RS06940 (NDY48_06940) 1241566..1242024 - 459 WP_012151458.1 N-6 DNA methylase -
NDY48_RS06945 (NDY48_06945) 1242094..1242225 - 132 WP_252081322.1 SAM-dependent methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-45)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-83)


Sequences

Toxin        


Download         Length: 48 a.a.        Molecular weight: 5357.17 Da        Isoelectric Point: 6.4361

>T247760 WP_012151451.1 NZ_CP098690:1237392-1237535 [Rickettsia rickettsii]
MRDHALIGNWKDCRDCHIKADLVLIYRKPDADTLELIQLGSNSTLGF

Download         Length: 144 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9516.03 Da        Isoelectric Point: 5.0916

>AT247760 WP_012151450.1 NZ_CP098690:1237037-1237300 [Rickettsia rickettsii]
MSADSIVRARINEDVKEEAALVLAAMGLTLSDAVRMLLFRVAREKALPFEPLIPNDETIKAMKAARSGKLVHVGNINNLL
SDLNEND

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3AWA1

Antitoxin

Source ID Structure
AlphaFold DB H8LNX5

References