Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-RelB
Location 1237581..1238079 Replicon chromosome
Accession NZ_CP098689
Organism Rickettsia rickettsii strain Taiacu

Toxin (Protein)


Gene name relE Uniprot ID A0A0H3AWA1
Locus tag NDY49_RS06940 Protein ID WP_012151451.1
Coordinates 1237936..1238079 (+) Length 48 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID H8LNX5
Locus tag NDY49_RS06935 Protein ID WP_012151450.1
Coordinates 1237581..1237844 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NDY49_RS06895 (NDY49_06895) 1232826..1232942 + 117 WP_080508248.1 palindromic element RPE1 domain-containing protein -
NDY49_RS06900 (NDY49_06900) 1232994..1233689 - 696 WP_012151442.1 TIGR02281 family clan AA aspartic protease -
NDY49_RS06905 (NDY49_06905) 1233750..1233968 - 219 WP_012151443.1 serine hydrolase -
NDY49_RS06910 (NDY49_06910) 1233993..1234184 - 192 WP_012262643.1 hypothetical protein -
NDY49_RS07255 1234613..1234747 - 135 WP_012151446.1 hypothetical protein -
NDY49_RS06915 (NDY49_06915) 1234891..1235130 - 240 WP_012151447.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
NDY49_RS06920 (NDY49_06920) 1235335..1236057 - 723 WP_010977895.1 amino acid ABC transporter ATP-binding protein -
NDY49_RS06925 (NDY49_06925) 1236061..1236825 - 765 WP_012151448.1 MBL fold metallo-hydrolase -
NDY49_RS06930 (NDY49_06930) 1236840..1237487 + 648 WP_012151449.1 phosphatase PAP2 family protein -
NDY49_RS06935 (NDY49_06935) 1237581..1237844 + 264 WP_012151450.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
NDY49_RS06940 (NDY49_06940) 1237936..1238079 + 144 WP_012151451.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
NDY49_RS06945 (NDY49_06945) 1238215..1239297 + 1083 WP_014362438.1 LptF/LptG family permease -
NDY49_RS06950 (NDY49_06950) 1239303..1239767 - 465 WP_012151453.1 DNA polymerase III subunit chi -
NDY49_RS06960 (NDY49_06960) 1239967..1241112 - 1146 WP_012151455.1 succinyl-diaminopimelate desuccinylase -
NDY49_RS06965 (NDY49_06965) 1241116..1241370 - 255 WP_012151456.1 restriction endonuclease subunit S -
NDY49_RS06970 (NDY49_06970) 1241674..1241802 - 129 WP_230453655.1 hypothetical protein -
NDY49_RS06975 (NDY49_06975) 1241870..1242061 - 192 WP_014362439.1 hypothetical protein -
NDY49_RS06980 (NDY49_06980) 1242110..1242568 - 459 WP_012151458.1 N-6 DNA methylase -
NDY49_RS06985 (NDY49_06985) 1242638..1242769 - 132 WP_252081322.1 SAM-dependent methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-45)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-83)


Sequences

Toxin        


Download         Length: 48 a.a.        Molecular weight: 5357.17 Da        Isoelectric Point: 6.4361

>T247759 WP_012151451.1 NZ_CP098689:1237936-1238079 [Rickettsia rickettsii]
MRDHALIGNWKDCRDCHIKADLVLIYRKPDADTLELIQLGSNSTLGF

Download         Length: 144 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9516.03 Da        Isoelectric Point: 5.0916

>AT247759 WP_012151450.1 NZ_CP098689:1237581-1237844 [Rickettsia rickettsii]
MSADSIVRARINEDVKEEAALVLAAMGLTLSDAVRMLLFRVAREKALPFEPLIPNDETIKAMKAARSGKLVHVGNINNLL
SDLNEND

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3AWA1

Antitoxin

Source ID Structure
AlphaFold DB H8LNX5

References