247757

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YoeB-RelB
Location 3205268..3205779 Replicon chromosome
Accession NZ_CP098611
Organism Phormidium yuhuli AB48

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag NEA10_RS13655 Protein ID WP_252661237.1
Coordinates 3205519..3205779 (+) Length 87 a.a.

Antitoxin (Protein)


Gene name relE Uniprot ID -
Locus tag NEA10_RS13650 Protein ID WP_252661229.1
Coordinates 3205268..3205522 (+) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NEA10_RS13625 (NEA10_13625) 3201800..3202309 + 510 WP_252661212.1 type II secretion system protein -
NEA10_RS13630 (NEA10_13630) 3202368..3202859 + 492 WP_252661214.1 hypothetical protein -
NEA10_RS13635 (NEA10_13635) 3202959..3203444 + 486 WP_252661216.1 hypothetical protein -
NEA10_RS13640 (NEA10_13640) 3203547..3204116 + 570 WP_252661218.1 Uma2 family endonuclease -
NEA10_RS13645 (NEA10_13645) 3204206..3204880 + 675 WP_252661220.1 Uma2 family endonuclease -
NEA10_RS13650 (NEA10_13650) 3205268..3205522 + 255 WP_252661229.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NEA10_RS13655 (NEA10_13655) 3205519..3205779 + 261 WP_252661237.1 Txe/YoeB family addiction module toxin Toxin
NEA10_RS13660 (NEA10_13660) 3205876..3206073 + 198 WP_252661239.1 DegT/DnrJ/EryC1/StrS family aminotransferase -
NEA10_RS13665 (NEA10_13665) 3206103..3206762 + 660 WP_252661241.1 Uma2 family endonuclease -
NEA10_RS13670 (NEA10_13670) 3206831..3207514 + 684 WP_252661243.1 Uma2 family endonuclease -
NEA10_RS13675 (NEA10_13675) 3207523..3207666 + 144 WP_252661245.1 hypothetical protein -
NEA10_RS13680 (NEA10_13680) 3207715..3208389 + 675 WP_252661247.1 Uma2 family endonuclease -
NEA10_RS13685 (NEA10_13685) 3208407..3208640 + 234 WP_252661248.1 UPF0175 family protein -
NEA10_RS13690 (NEA10_13690) 3208633..3209091 + 459 WP_252661250.1 DUF3368 domain-containing protein -
NEA10_RS13695 (NEA10_13695) 3209090..3209252 + 163 Protein_2714 Uma2 family endonuclease -
NEA10_RS13700 (NEA10_13700) 3209540..3209629 + 90 Protein_2715 flagellar assembly protein H -
NEA10_RS13705 (NEA10_13705) 3209844..3210038 + 195 WP_252661252.1 hypothetical protein -
NEA10_RS13710 (NEA10_13710) 3210035..3210247 + 213 WP_252661254.1 2-phospho-L-lactate guanylyltransferase -
NEA10_RS13715 (NEA10_13715) 3210517..3210693 + 177 WP_252661256.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 10268.99 Da        Isoelectric Point: 9.7932

>T247757 WP_252661237.1 NZ_CP098611:3205519-3205779 [Phormidium yuhuli AB48]
MKVSFTELAWSDYLWLQKKDKRLLKRVNLLIKDVMRDAFEGIGKPEPLKGNLSGYWSRRIDGEHRLVYQVVGDEILIISC
RFHYER

Download         Length: 261 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9584.89 Da        Isoelectric Point: 4.1317

>AT247757 WP_252661229.1 NZ_CP098611:3205268-3205522 [Phormidium yuhuli AB48]
MKTIETQQAKQQLDEMIDQVIIDVEPTILRNQKGQEAVLMSLEEFSAWRETIYLLSNPANASHLLESIKQAESGQTILKE
LLDE

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References