Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 5657512..5658076 | Replicon | chromosome |
Accession | NZ_CP098609 | ||
Organism | Streptomyces filamentosus strain L30 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | V6UJ86 |
Locus tag | K7395_RS25170 | Protein ID | WP_006124458.1 |
Coordinates | 5657729..5658076 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | W9FME8 |
Locus tag | K7395_RS25165 | Protein ID | WP_006124459.1 |
Coordinates | 5657512..5657742 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K7395_RS25140 (K7395_25140) | 5652583..5653125 | - | 543 | WP_010070705.1 | hypothetical protein | - |
K7395_RS25145 (K7395_25145) | 5653232..5653867 | - | 636 | WP_010070704.1 | ABC transporter ATP-binding protein | - |
K7395_RS25150 (K7395_25150) | 5653866..5654162 | + | 297 | WP_010070703.1 | hypothetical protein | - |
K7395_RS25155 (K7395_25155) | 5654256..5656832 | - | 2577 | WP_006124461.1 | aminopeptidase N | - |
K7395_RS25160 (K7395_25160) | 5656957..5657457 | + | 501 | WP_006124460.1 | DUF1203 domain-containing protein | - |
K7395_RS25165 (K7395_25165) | 5657512..5657742 | + | 231 | WP_006124459.1 | hypothetical protein | Antitoxin |
K7395_RS25170 (K7395_25170) | 5657729..5658076 | + | 348 | WP_006124458.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
K7395_RS25175 (K7395_25175) | 5658158..5659186 | - | 1029 | WP_006124457.1 | aspartate-semialdehyde dehydrogenase | - |
K7395_RS25180 (K7395_25180) | 5659457..5662765 | - | 3309 | WP_199781644.1 | S8 family serine peptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12803.83 Da Isoelectric Point: 11.2356
>T247751 WP_006124458.1 NZ_CP098609:5657729-5658076 [Streptomyces filamentosus]
MRRGDIYLIDFEPVRGSEANKARPALIVSNDGANATVERLERGVLTVVPLTSNTARVFPFQVLLPADECRLAVDSKAQCE
QVRAVSPQRLKRRIGSVPRRRMADVDAALRRHLAL
MRRGDIYLIDFEPVRGSEANKARPALIVSNDGANATVERLERGVLTVVPLTSNTARVFPFQVLLPADECRLAVDSKAQCE
QVRAVSPQRLKRRIGSVPRRRMADVDAALRRHLAL
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Y6HI13 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1A9D4H7 |