Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Fic(toxin) |
Location | 5213736..5214301 | Replicon | chromosome |
Accession | NZ_CP098609 | ||
Organism | Streptomyces filamentosus strain L30 |
Toxin (Protein)
Gene name | doc | Uniprot ID | V6UA48 |
Locus tag | K7395_RS23090 | Protein ID | WP_010070918.1 |
Coordinates | 5213933..5214301 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | V6UAG4 |
Locus tag | K7395_RS23085 | Protein ID | WP_006124909.1 |
Coordinates | 5213736..5213933 (+) | Length | 66 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K7395_RS23065 (K7395_23065) | 5210286..5210966 | + | 681 | WP_006124913.1 | hypothetical protein | - |
K7395_RS23070 (K7395_23070) | 5211034..5211810 | + | 777 | WP_006124912.1 | hypothetical protein | - |
K7395_RS23080 (K7395_23080) | 5212195..5213700 | + | 1506 | WP_252096546.1 | MFS transporter | - |
K7395_RS23085 (K7395_23085) | 5213736..5213933 | + | 198 | WP_006124909.1 | hypothetical protein | Antitoxin |
K7395_RS23090 (K7395_23090) | 5213933..5214301 | + | 369 | WP_010070918.1 | Fic family protein | Toxin |
K7395_RS23095 (K7395_23095) | 5214470..5216254 | + | 1785 | WP_006124907.1 | DEAD/DEAH box helicase | - |
K7395_RS23100 (K7395_23100) | 5216780..5217424 | + | 645 | WP_006124906.1 | helix-turn-helix domain-containing protein | - |
K7395_RS23105 (K7395_23105) | 5217534..5218322 | + | 789 | WP_006124905.1 | S16 family serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13709.69 Da Isoelectric Point: 4.8727
>T247750 WP_010070918.1 NZ_CP098609:5213933-5214301 [Streptomyces filamentosus]
MQYLTLPELLKLAERLGAAEVRDYGLLESALTRPQASVFGQDAYPDVWQKAAALMESLARNHGLIDGNKRIAWYATWVFL
HLNGHPLDPDFDVDEAERFVLAACQGALDMPKIAEQLPRFAR
MQYLTLPELLKLAERLGAAEVRDYGLLESALTRPQASVFGQDAYPDVWQKAAALMESLARNHGLIDGNKRIAWYATWVFL
HLNGHPLDPDFDVDEAERFVLAACQGALDMPKIAEQLPRFAR
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|