Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 3419732..3420292 | Replicon | chromosome |
Accession | NZ_CP098609 | ||
Organism | Streptomyces filamentosus strain L30 |
Toxin (Protein)
Gene name | relE | Uniprot ID | V6UJL0 |
Locus tag | K7395_RS14710 | Protein ID | WP_006126599.1 |
Coordinates | 3420014..3420292 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | K7395_RS14705 | Protein ID | WP_202473555.1 |
Coordinates | 3419732..3420010 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K7395_RS14685 (K7395_14685) | 3415079..3416272 | + | 1194 | WP_010071676.1 | ABC transporter permease | - |
K7395_RS14690 (K7395_14690) | 3416322..3417419 | - | 1098 | WP_006126603.1 | type II CAAX endopeptidase family protein | - |
K7395_RS14695 (K7395_14695) | 3417663..3418448 | + | 786 | WP_006126602.1 | SAM-dependent methyltransferase | - |
K7395_RS14700 (K7395_14700) | 3418421..3419536 | - | 1116 | WP_006126601.1 | hypothetical protein | - |
K7395_RS14705 (K7395_14705) | 3419732..3420010 | + | 279 | WP_202473555.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
K7395_RS14710 (K7395_14710) | 3420014..3420292 | + | 279 | WP_006126599.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
K7395_RS14715 (K7395_14715) | 3420338..3420952 | - | 615 | WP_006126598.1 | TetR-like C-terminal domain-containing protein | - |
K7395_RS14720 (K7395_14720) | 3421021..3422367 | + | 1347 | WP_006126597.1 | alpha/beta hydrolase | - |
K7395_RS14725 (K7395_14725) | 3422439..3422771 | + | 333 | WP_010071670.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
K7395_RS14730 (K7395_14730) | 3422799..3423233 | - | 435 | WP_032771498.1 | hypothetical protein | - |
K7395_RS14735 (K7395_14735) | 3423351..3424121 | + | 771 | WP_032771497.1 | helix-turn-helix transcriptional regulator | - |
K7395_RS14740 (K7395_14740) | 3424118..3424321 | + | 204 | WP_006126593.1 | DUF397 domain-containing protein | - |
K7395_RS14745 (K7395_14745) | 3424371..3424778 | + | 408 | WP_234013144.1 | DUF6336 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10591.24 Da Isoelectric Point: 10.4171
>T247748 WP_006126599.1 NZ_CP098609:3420014-3420292 [Streptomyces filamentosus]
MGHVTRFTAHAQRDLLKIPLPEARRILGRLADLQKALDAGELSAFDVKPLQGHDARWRLRVGDYRAVYTVEDGQLIVWVL
AVAHRREIYRSF
MGHVTRFTAHAQRDLLKIPLPEARRILGRLADLQKALDAGELSAFDVKPLQGHDARWRLRVGDYRAVYTVEDGQLIVWVL
AVAHRREIYRSF
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|