Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3871461..3872239 | Replicon | chromosome |
Accession | NZ_CP098604 | ||
Organism | Xanthomonas hortorum pv. pelargonii strain OSU493 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | NDY25_RS16710 | Protein ID | WP_168958945.1 |
Coordinates | 3871461..3871952 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | - |
Locus tag | NDY25_RS16715 | Protein ID | WP_168958946.1 |
Coordinates | 3871949..3872239 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDY25_RS16695 (NDY25_16670) | 3868044..3868964 | + | 921 | WP_168958943.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
NDY25_RS16700 (NDY25_16675) | 3869308..3869985 | + | 678 | WP_006448355.1 | response regulator transcription factor | - |
NDY25_RS16705 (NDY25_16680) | 3869978..3871312 | + | 1335 | WP_168958944.1 | HAMP domain-containing sensor histidine kinase | - |
NDY25_RS16710 (NDY25_16685) | 3871461..3871952 | - | 492 | WP_168958945.1 | GNAT family N-acetyltransferase | Toxin |
NDY25_RS16715 (NDY25_16690) | 3871949..3872239 | - | 291 | WP_168958946.1 | DUF1778 domain-containing protein | Antitoxin |
NDY25_RS16720 (NDY25_16695) | 3872315..3872716 | - | 402 | WP_168958947.1 | SymE family type I addiction module toxin | - |
NDY25_RS16725 (NDY25_16700) | 3873248..3873871 | - | 624 | WP_168958948.1 | dephospho-CoA kinase | - |
NDY25_RS16730 (NDY25_16705) | 3873885..3874748 | - | 864 | WP_016849610.1 | A24 family peptidase | - |
NDY25_RS16735 (NDY25_16710) | 3874755..3876014 | - | 1260 | WP_168958949.1 | type II secretion system F family protein | - |
NDY25_RS16740 (NDY25_16715) | 3876365..3876790 | + | 426 | WP_168958950.1 | pilin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 3792278..3942189 | 149911 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17592.27 Da Isoelectric Point: 9.6230
>T247747 WP_168958945.1 NZ_CP098604:c3871952-3871461 [Xanthomonas hortorum pv. pelargonii]
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACADDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALVRDAGKRVLHAADTIGIRGLLVHALSTDAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACADDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALVRDAGKRVLHAADTIGIRGLLVHALSTDAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|