Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YoeB-YefM |
Location | 1089567..1090072 | Replicon | chromosome |
Accession | NZ_CP098604 | ||
Organism | Xanthomonas hortorum pv. pelargonii strain OSU493 |
Toxin (Protein)
Gene name | relE | Uniprot ID | V7ZHE2 |
Locus tag | NDY25_RS04705 | Protein ID | WP_023902910.1 |
Coordinates | 1089815..1090072 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | relE | Uniprot ID | A0A6V7E8M0 |
Locus tag | NDY25_RS04700 | Protein ID | WP_043888988.1 |
Coordinates | 1089567..1089818 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDY25_RS04680 (NDY25_04665) | 1084940..1086094 | - | 1155 | WP_168959477.1 | 2-methylcitrate synthase | - |
NDY25_RS04685 (NDY25_04670) | 1086170..1087018 | - | 849 | WP_256627969.1 | methylisocitrate lyase | - |
NDY25_RS04690 (NDY25_04675) | 1087193..1088812 | + | 1620 | WP_180336594.1 | propionate catabolism operon regulatory protein PrpR | - |
NDY25_RS04695 (NDY25_04680) | 1089055..1089381 | - | 327 | WP_168959474.1 | hypothetical protein | - |
NDY25_RS04700 (NDY25_04685) | 1089567..1089818 | + | 252 | WP_043888988.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
NDY25_RS04705 (NDY25_04690) | 1089815..1090072 | + | 258 | WP_023902910.1 | Txe/YoeB family addiction module toxin | Toxin |
NDY25_RS04715 (NDY25_04700) | 1090579..1090932 | - | 354 | WP_003483889.1 | PilZ domain-containing protein | - |
NDY25_RS04720 (NDY25_04705) | 1090929..1091888 | - | 960 | WP_168959473.1 | DNA polymerase III subunit delta' | - |
NDY25_RS04725 (NDY25_04710) | 1091885..1092946 | - | 1062 | WP_233366604.1 | endolytic transglycosylase MltG | - |
NDY25_RS04730 (NDY25_04715) | 1093019..1094374 | - | 1356 | WP_168959472.1 | aminodeoxychorismate synthase component I | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 10170.68 Da Isoelectric Point: 9.6587
>T247743 WP_023902910.1 NZ_CP098604:1089815-1090072 [Xanthomonas hortorum pv. pelargonii]
VILQFADNAWEDYLYWQQTDKKMLKRINELIKAIQRDPFQGIGKPEPLRHALAGYWSRRINDEHRIVYKAENGILLIAQA
RYHYA
VILQFADNAWEDYLYWQQTDKKMLKRINELIKAIQRDPFQGIGKPEPLRHALAGYWSRRINDEHRIVYKAENGILLIAQA
RYHYA
Download Length: 258 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6V7E8N0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6V7E8M0 |