Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1635012..1635697 | Replicon | chromosome |
| Accession | NZ_CP098548 | ||
| Organism | Neisseria gonorrhoeae strain 9343 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | NDQ69_RS08490 | Protein ID | WP_003689143.1 |
| Coordinates | 1635515..1635697 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | NDQ69_RS08485 | Protein ID | WP_003691454.1 |
| Coordinates | 1635012..1635413 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDQ69_RS08445 (NDQ69_08390) | 1630430..1630612 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| NDQ69_RS08450 (NDQ69_11870) | 1630752..1631438 | - | 687 | WP_010357532.1 | hypothetical protein | - |
| NDQ69_RS08455 (NDQ69_08405) | 1631507..1631668 | - | 162 | WP_003691530.1 | hypothetical protein | - |
| NDQ69_RS08460 (NDQ69_08410) | 1631665..1631940 | - | 276 | WP_033911205.1 | hypothetical protein | - |
| NDQ69_RS08465 (NDQ69_08415) | 1632093..1632425 | - | 333 | WP_003695500.1 | hypothetical protein | - |
| NDQ69_RS08470 (NDQ69_08420) | 1632971..1633732 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| NDQ69_RS08475 (NDQ69_08425) | 1633821..1634237 | - | 417 | WP_003700378.1 | hypothetical protein | - |
| NDQ69_RS08480 (NDQ69_08430) | 1634246..1634830 | - | 585 | WP_003693477.1 | Panacea domain-containing protein | - |
| NDQ69_RS08485 (NDQ69_08435) | 1635012..1635413 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NDQ69_RS08490 (NDQ69_08440) | 1635515..1635697 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NDQ69_RS08495 (NDQ69_08445) | 1635867..1636685 | - | 819 | WP_003693474.1 | DUF3037 domain-containing protein | - |
| NDQ69_RS08500 (NDQ69_08450) | 1636960..1637715 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| NDQ69_RS08505 (NDQ69_08455) | 1637852..1638037 | + | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| NDQ69_RS08510 (NDQ69_08460) | 1638126..1638281 | + | 156 | WP_003698902.1 | hypothetical protein | - |
| NDQ69_RS08515 (NDQ69_08465) | 1638258..1638446 | - | 189 | WP_003691445.1 | hypothetical protein | - |
| NDQ69_RS08520 (NDQ69_08470) | 1638619..1638846 | + | 228 | WP_003705596.1 | helix-turn-helix domain-containing protein | - |
| NDQ69_RS08525 (NDQ69_08475) | 1638843..1639310 | + | 468 | WP_229433445.1 | helix-turn-helix domain-containing protein | - |
| NDQ69_RS08530 (NDQ69_08480) | 1639324..1639854 | + | 531 | WP_229931507.1 | hypothetical protein | - |
| NDQ69_RS08535 (NDQ69_08485) | 1639869..1640648 | + | 780 | WP_025455898.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1619447..1652759 | 33312 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T247742 WP_003689143.1 NZ_CP098548:c1635697-1635515 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT247742 WP_003691454.1 NZ_CP098548:c1635413-1635012 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|