Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1635012..1635697 Replicon chromosome
Accession NZ_CP098548
Organism Neisseria gonorrhoeae strain 9343

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag NDQ69_RS08490 Protein ID WP_003689143.1
Coordinates 1635515..1635697 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag NDQ69_RS08485 Protein ID WP_003691454.1
Coordinates 1635012..1635413 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NDQ69_RS08445 (NDQ69_08390) 1630430..1630612 - 183 WP_003691535.1 hypothetical protein -
NDQ69_RS08450 (NDQ69_11870) 1630752..1631438 - 687 WP_010357532.1 hypothetical protein -
NDQ69_RS08455 (NDQ69_08405) 1631507..1631668 - 162 WP_003691530.1 hypothetical protein -
NDQ69_RS08460 (NDQ69_08410) 1631665..1631940 - 276 WP_033911205.1 hypothetical protein -
NDQ69_RS08465 (NDQ69_08415) 1632093..1632425 - 333 WP_003695500.1 hypothetical protein -
NDQ69_RS08470 (NDQ69_08420) 1632971..1633732 + 762 WP_012503753.1 hypothetical protein -
NDQ69_RS08475 (NDQ69_08425) 1633821..1634237 - 417 WP_003700378.1 hypothetical protein -
NDQ69_RS08480 (NDQ69_08430) 1634246..1634830 - 585 WP_003693477.1 Panacea domain-containing protein -
NDQ69_RS08485 (NDQ69_08435) 1635012..1635413 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NDQ69_RS08490 (NDQ69_08440) 1635515..1635697 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
NDQ69_RS08495 (NDQ69_08445) 1635867..1636685 - 819 WP_003693474.1 DUF3037 domain-containing protein -
NDQ69_RS08500 (NDQ69_08450) 1636960..1637715 - 756 WP_003693472.1 LexA family transcriptional regulator -
NDQ69_RS08505 (NDQ69_08455) 1637852..1638037 + 186 WP_002238713.1 Cro/CI family transcriptional regulator -
NDQ69_RS08510 (NDQ69_08460) 1638126..1638281 + 156 WP_003698902.1 hypothetical protein -
NDQ69_RS08515 (NDQ69_08465) 1638258..1638446 - 189 WP_003691445.1 hypothetical protein -
NDQ69_RS08520 (NDQ69_08470) 1638619..1638846 + 228 WP_003705596.1 helix-turn-helix domain-containing protein -
NDQ69_RS08525 (NDQ69_08475) 1638843..1639310 + 468 WP_229433445.1 helix-turn-helix domain-containing protein -
NDQ69_RS08530 (NDQ69_08480) 1639324..1639854 + 531 WP_229931507.1 hypothetical protein -
NDQ69_RS08535 (NDQ69_08485) 1639869..1640648 + 780 WP_025455898.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1619447..1652759 33312


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T247742 WP_003689143.1 NZ_CP098548:c1635697-1635515 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT247742 WP_003691454.1 NZ_CP098548:c1635413-1635012 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References