Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 651379..652034 | Replicon | chromosome |
| Accession | NZ_CP098548 | ||
| Organism | Neisseria gonorrhoeae strain 9343 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NDQ69_RS03475 | Protein ID | WP_229931500.1 |
| Coordinates | 651615..652034 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q5F881 |
| Locus tag | NDQ69_RS03470 | Protein ID | WP_003688410.1 |
| Coordinates | 651379..651615 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDQ69_RS03440 (NDQ69_03405) | 646514..646801 | + | 288 | WP_003688407.1 | hypothetical protein | - |
| NDQ69_RS03445 (NDQ69_03410) | 646873..648039 | + | 1167 | WP_003699872.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| NDQ69_RS03450 (NDQ69_03415) | 648050..648940 | + | 891 | WP_229931474.1 | succinate--CoA ligase subunit alpha | - |
| NDQ69_RS03455 (NDQ69_03420) | 649323..649709 | - | 387 | Protein_674 | transposase | - |
| NDQ69_RS03460 (NDQ69_11765) | 649948..650349 | + | 402 | WP_020996834.1 | helix-turn-helix domain-containing protein | - |
| NDQ69_RS03465 (NDQ69_03430) | 650354..650932 | + | 579 | WP_003697246.1 | IS3 family transposase | - |
| NDQ69_RS03470 (NDQ69_03435) | 651379..651615 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
| NDQ69_RS03475 (NDQ69_03440) | 651615..652034 | + | 420 | WP_229931500.1 | type II toxin-antitoxin system toxin FitB | Toxin |
| NDQ69_RS03480 (NDQ69_03445) | 652183..653637 | - | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| NDQ69_RS03485 (NDQ69_03450) | 653634..654335 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
| NDQ69_RS03490 (NDQ69_03455) | 654332..655111 | - | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
| NDQ69_RS03495 (NDQ69_03460) | 655259..656800 | + | 1542 | WP_003691084.1 | MDR family MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15336.67 Da Isoelectric Point: 5.5742
>T247741 WP_229931500.1 NZ_CP098548:651615-652034 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGWILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGWILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|