Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 948414..949069 | Replicon | chromosome |
Accession | NZ_CP098546 | ||
Organism | Neisseria gonorrhoeae strain 9126 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | NDQ67_RS04885 | Protein ID | WP_003691083.1 |
Coordinates | 948414..948833 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | NDQ67_RS04890 | Protein ID | WP_003688410.1 |
Coordinates | 948833..949069 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDQ67_RS04865 (NDQ67_04845) | 943648..945189 | - | 1542 | WP_003691084.1 | MDR family MFS transporter | - |
NDQ67_RS04870 (NDQ67_04850) | 945337..946116 | + | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
NDQ67_RS04875 (NDQ67_04855) | 946113..946814 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
NDQ67_RS04880 (NDQ67_04860) | 946811..948265 | + | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
NDQ67_RS04885 (NDQ67_04865) | 948414..948833 | - | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
NDQ67_RS04890 (NDQ67_04870) | 948833..949069 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
NDQ67_RS04895 (NDQ67_04875) | 949516..950094 | - | 579 | WP_003697246.1 | IS3 family transposase | - |
NDQ67_RS04900 (NDQ67_04880) | 950099..950500 | - | 402 | WP_020996834.1 | helix-turn-helix domain-containing protein | - |
NDQ67_RS04905 (NDQ67_04885) | 950739..951125 | + | 387 | Protein_963 | transposase | - |
NDQ67_RS04910 (NDQ67_04890) | 951508..952398 | - | 891 | WP_003693285.1 | succinate--CoA ligase subunit alpha | - |
NDQ67_RS04915 (NDQ67_04895) | 952409..953575 | - | 1167 | WP_003699872.1 | ADP-forming succinate--CoA ligase subunit beta | - |
NDQ67_RS04920 (NDQ67_04900) | 953647..953934 | - | 288 | WP_003688407.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T247738 WP_003691083.1 NZ_CP098546:c948833-948414 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|