Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 1016700..1017355 | Replicon | chromosome |
Accession | NZ_CP098544 | ||
Organism | Neisseria gonorrhoeae strain 10296 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | NDQ64_RS05270 | Protein ID | WP_003691083.1 |
Coordinates | 1016700..1017119 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | NDQ64_RS05275 | Protein ID | WP_003688410.1 |
Coordinates | 1017119..1017355 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDQ64_RS05250 (NDQ64_05190) | 1011934..1013475 | - | 1542 | WP_003697015.1 | MDR family MFS transporter | - |
NDQ64_RS05255 (NDQ64_05195) | 1013623..1014402 | + | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
NDQ64_RS05260 (NDQ64_05200) | 1014399..1015100 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
NDQ64_RS05265 (NDQ64_05205) | 1015097..1016551 | + | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
NDQ64_RS05270 (NDQ64_05210) | 1016700..1017119 | - | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
NDQ64_RS05275 (NDQ64_05215) | 1017119..1017355 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
NDQ64_RS05280 (NDQ64_05220) | 1017802..1018380 | - | 579 | WP_003688041.1 | IS3 family transposase | - |
NDQ64_RS05285 (NDQ64_05225) | 1018385..1018786 | - | 402 | WP_020997339.1 | helix-turn-helix domain-containing protein | - |
NDQ64_RS05290 (NDQ64_05230) | 1019025..1019411 | + | 387 | Protein_1035 | transposase | - |
NDQ64_RS05295 (NDQ64_05235) | 1019794..1020684 | - | 891 | WP_002244992.1 | succinate--CoA ligase subunit alpha | - |
NDQ64_RS05300 (NDQ64_05240) | 1020695..1021861 | - | 1167 | WP_003699872.1 | ADP-forming succinate--CoA ligase subunit beta | - |
NDQ64_RS05305 (NDQ64_05245) | 1021933..1022220 | - | 288 | WP_003688407.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1019004..1019477 | 473 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T247736 WP_003691083.1 NZ_CP098544:c1017119-1016700 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|