Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 533278..533963 Replicon chromosome
Accession NZ_CP098544
Organism Neisseria gonorrhoeae strain 10296

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag NDQ64_RS02795 Protein ID WP_003689143.1
Coordinates 533781..533963 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag NDQ64_RS02790 Protein ID WP_003691454.1
Coordinates 533278..533679 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NDQ64_RS02735 (NDQ64_02715) 528292..528507 - 216 WP_003691538.1 hypothetical protein -
NDQ64_RS02740 (NDQ64_02720) 528559..529050 - 492 WP_047918703.1 siphovirus Gp157 family protein -
NDQ64_RS02745 (NDQ64_02725) 529047..529229 - 183 WP_003691535.1 hypothetical protein -
NDQ64_RS02750 (NDQ64_02730) 529369..530055 - 687 WP_010951053.1 hypothetical protein -
NDQ64_RS02755 (NDQ64_02735) 530124..530285 - 162 WP_003702497.1 hypothetical protein -
NDQ64_RS02760 (NDQ64_02740) 530282..530560 - 279 WP_003691529.1 hypothetical protein -
NDQ64_RS02765 (NDQ64_02745) 530713..531045 - 333 WP_003687946.1 hypothetical protein -
NDQ64_RS02770 (NDQ64_02750) 531186..531491 - 306 WP_260244314.1 hypothetical protein -
NDQ64_RS02775 (NDQ64_02755) 531488..531964 - 477 WP_012504141.1 hypothetical protein -
NDQ64_RS02780 (NDQ64_02760) 531997..532197 - 201 WP_003704298.1 hypothetical protein -
NDQ64_RS02785 (NDQ64_02765) 532418..533179 + 762 WP_012503753.1 hypothetical protein -
NDQ64_RS02790 (NDQ64_02770) 533278..533679 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NDQ64_RS02795 (NDQ64_02775) 533781..533963 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
NDQ64_RS02800 (NDQ64_02780) 534133..534951 - 819 WP_025455900.1 DUF3037 domain-containing protein -
NDQ64_RS02805 (NDQ64_02785) 534948..535646 - 699 WP_003689139.1 hypothetical protein -
NDQ64_RS02810 (NDQ64_02790) 535885..536583 - 699 WP_002212401.1 S24 family peptidase -
NDQ64_RS02815 (NDQ64_02795) 536623..537309 - 687 WP_012503751.1 helix-turn-helix transcriptional regulator -
NDQ64_RS02820 (NDQ64_02800) 537525..537659 + 135 WP_229684436.1 YdaS family helix-turn-helix protein -
NDQ64_RS02825 (NDQ64_02805) 537661..537861 + 201 WP_012503750.1 hypothetical protein -
NDQ64_RS02830 (NDQ64_02810) 538058..538957 + 900 WP_041421306.1 replication protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - pilH / pilI / pilJ / pilK / pilX 515514..578124 62610


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T247735 WP_003689143.1 NZ_CP098544:c533963-533781 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT247735 WP_003691454.1 NZ_CP098544:c533679-533278 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References