Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 533278..533963 | Replicon | chromosome |
| Accession | NZ_CP098544 | ||
| Organism | Neisseria gonorrhoeae strain 10296 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | NDQ64_RS02795 | Protein ID | WP_003689143.1 |
| Coordinates | 533781..533963 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | NDQ64_RS02790 | Protein ID | WP_003691454.1 |
| Coordinates | 533278..533679 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDQ64_RS02735 (NDQ64_02715) | 528292..528507 | - | 216 | WP_003691538.1 | hypothetical protein | - |
| NDQ64_RS02740 (NDQ64_02720) | 528559..529050 | - | 492 | WP_047918703.1 | siphovirus Gp157 family protein | - |
| NDQ64_RS02745 (NDQ64_02725) | 529047..529229 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| NDQ64_RS02750 (NDQ64_02730) | 529369..530055 | - | 687 | WP_010951053.1 | hypothetical protein | - |
| NDQ64_RS02755 (NDQ64_02735) | 530124..530285 | - | 162 | WP_003702497.1 | hypothetical protein | - |
| NDQ64_RS02760 (NDQ64_02740) | 530282..530560 | - | 279 | WP_003691529.1 | hypothetical protein | - |
| NDQ64_RS02765 (NDQ64_02745) | 530713..531045 | - | 333 | WP_003687946.1 | hypothetical protein | - |
| NDQ64_RS02770 (NDQ64_02750) | 531186..531491 | - | 306 | WP_260244314.1 | hypothetical protein | - |
| NDQ64_RS02775 (NDQ64_02755) | 531488..531964 | - | 477 | WP_012504141.1 | hypothetical protein | - |
| NDQ64_RS02780 (NDQ64_02760) | 531997..532197 | - | 201 | WP_003704298.1 | hypothetical protein | - |
| NDQ64_RS02785 (NDQ64_02765) | 532418..533179 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| NDQ64_RS02790 (NDQ64_02770) | 533278..533679 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NDQ64_RS02795 (NDQ64_02775) | 533781..533963 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NDQ64_RS02800 (NDQ64_02780) | 534133..534951 | - | 819 | WP_025455900.1 | DUF3037 domain-containing protein | - |
| NDQ64_RS02805 (NDQ64_02785) | 534948..535646 | - | 699 | WP_003689139.1 | hypothetical protein | - |
| NDQ64_RS02810 (NDQ64_02790) | 535885..536583 | - | 699 | WP_002212401.1 | S24 family peptidase | - |
| NDQ64_RS02815 (NDQ64_02795) | 536623..537309 | - | 687 | WP_012503751.1 | helix-turn-helix transcriptional regulator | - |
| NDQ64_RS02820 (NDQ64_02800) | 537525..537659 | + | 135 | WP_229684436.1 | YdaS family helix-turn-helix protein | - |
| NDQ64_RS02825 (NDQ64_02805) | 537661..537861 | + | 201 | WP_012503750.1 | hypothetical protein | - |
| NDQ64_RS02830 (NDQ64_02810) | 538058..538957 | + | 900 | WP_041421306.1 | replication protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | pilH / pilI / pilJ / pilK / pilX | 515514..578124 | 62610 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T247735 WP_003689143.1 NZ_CP098544:c533963-533781 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT247735 WP_003691454.1 NZ_CP098544:c533679-533278 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|