Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1521723..1522408 | Replicon | chromosome |
| Accession | NZ_CP098542 | ||
| Organism | Neisseria gonorrhoeae strain 10704 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | NDQ68_RS07900 | Protein ID | WP_003689143.1 |
| Coordinates | 1522226..1522408 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | NDQ68_RS07895 | Protein ID | WP_003691454.1 |
| Coordinates | 1521723..1522124 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDQ68_RS07850 (NDQ68_07780) | 1517141..1517323 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| NDQ68_RS07855 (NDQ68_07785) | 1517463..1518149 | - | 687 | WP_010951053.1 | hypothetical protein | - |
| NDQ68_RS07860 (NDQ68_07790) | 1518218..1518379 | - | 162 | WP_003691530.1 | hypothetical protein | - |
| NDQ68_RS07865 (NDQ68_07795) | 1518376..1518651 | - | 276 | WP_229931746.1 | hypothetical protein | - |
| NDQ68_RS07870 (NDQ68_07800) | 1518804..1519136 | - | 333 | WP_003695500.1 | hypothetical protein | - |
| NDQ68_RS07875 (NDQ68_07805) | 1519277..1519441 | - | 165 | WP_003700376.1 | hypothetical protein | - |
| NDQ68_RS07880 (NDQ68_07810) | 1519682..1520443 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| NDQ68_RS07885 (NDQ68_07815) | 1520532..1520948 | - | 417 | WP_003700378.1 | hypothetical protein | - |
| NDQ68_RS07890 (NDQ68_07820) | 1520957..1521592 | - | 636 | WP_225602681.1 | Panacea domain-containing protein | - |
| NDQ68_RS07895 (NDQ68_07825) | 1521723..1522124 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NDQ68_RS07900 (NDQ68_07830) | 1522226..1522408 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NDQ68_RS07905 (NDQ68_07835) | 1522578..1523396 | - | 819 | WP_003693474.1 | DUF3037 domain-containing protein | - |
| NDQ68_RS07910 (NDQ68_07840) | 1523671..1524426 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| NDQ68_RS07915 (NDQ68_07845) | 1524563..1524748 | + | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| NDQ68_RS07920 (NDQ68_07850) | 1524837..1524992 | + | 156 | WP_003698902.1 | hypothetical protein | - |
| NDQ68_RS07925 (NDQ68_07855) | 1524969..1525157 | - | 189 | WP_003691445.1 | hypothetical protein | - |
| NDQ68_RS07930 (NDQ68_07860) | 1525330..1525557 | + | 228 | WP_003705596.1 | helix-turn-helix domain-containing protein | - |
| NDQ68_RS07935 (NDQ68_07865) | 1525554..1525976 | + | 423 | WP_229931774.1 | helix-turn-helix domain-containing protein | - |
| NDQ68_RS07940 (NDQ68_07870) | 1525990..1526508 | + | 519 | WP_025456213.1 | hypothetical protein | - |
| NDQ68_RS07945 (NDQ68_07875) | 1526523..1527302 | + | 780 | WP_025455898.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1507864..1541061 | 33197 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T247733 WP_003689143.1 NZ_CP098542:c1522408-1522226 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT247733 WP_003691454.1 NZ_CP098542:c1522124-1521723 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|