Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 652361..653016 | Replicon | chromosome |
| Accession | NZ_CP098542 | ||
| Organism | Neisseria gonorrhoeae strain 10704 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q5F882 |
| Locus tag | NDQ68_RS03480 | Protein ID | WP_003691083.1 |
| Coordinates | 652597..653016 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q5F881 |
| Locus tag | NDQ68_RS03475 | Protein ID | WP_003688410.1 |
| Coordinates | 652361..652597 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDQ68_RS03445 (NDQ68_03410) | 647496..647783 | + | 288 | WP_003688407.1 | hypothetical protein | - |
| NDQ68_RS03450 (NDQ68_03415) | 647855..649021 | + | 1167 | WP_003699872.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| NDQ68_RS03455 (NDQ68_03420) | 649032..649922 | + | 891 | WP_003693285.1 | succinate--CoA ligase subunit alpha | - |
| NDQ68_RS03460 (NDQ68_03425) | 650305..650691 | - | 387 | Protein_675 | IS110 family transposase | - |
| NDQ68_RS03465 (NDQ68_03430) | 651041..651331 | + | 291 | WP_047917062.1 | helix-turn-helix domain-containing protein | - |
| NDQ68_RS03470 (NDQ68_03435) | 651336..651914 | + | 579 | WP_003697246.1 | IS3 family transposase | - |
| NDQ68_RS03475 (NDQ68_03440) | 652361..652597 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
| NDQ68_RS03480 (NDQ68_03445) | 652597..653016 | + | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
| NDQ68_RS03485 (NDQ68_03450) | 653165..654619 | - | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| NDQ68_RS03490 (NDQ68_03455) | 654616..655317 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
| NDQ68_RS03495 (NDQ68_03460) | 655314..656093 | - | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
| NDQ68_RS03500 (NDQ68_03465) | 656241..657782 | + | 1542 | WP_003691084.1 | MDR family MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T247732 WP_003691083.1 NZ_CP098542:652597-653016 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|