Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1579395..1580080 | Replicon | chromosome |
| Accession | NZ_CP098538 | ||
| Organism | Neisseria gonorrhoeae strain ATCC 49226 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | NDQ65_RS08230 | Protein ID | WP_003689143.1 |
| Coordinates | 1579898..1580080 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | NDQ65_RS08225 | Protein ID | WP_003691454.1 |
| Coordinates | 1579395..1579796 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDQ65_RS08175 (NDQ65_08120) | 1574871..1575086 | - | 216 | WP_003691538.1 | hypothetical protein | - |
| NDQ65_RS08180 (NDQ65_08125) | 1575138..1575629 | - | 492 | WP_010357526.1 | siphovirus Gp157 family protein | - |
| NDQ65_RS08185 (NDQ65_08130) | 1575626..1575808 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| NDQ65_RS08190 (NDQ65_08135) | 1575948..1576634 | - | 687 | WP_082298587.1 | hypothetical protein | - |
| NDQ65_RS08195 (NDQ65_08140) | 1576703..1576864 | - | 162 | WP_003693867.1 | hypothetical protein | - |
| NDQ65_RS08200 (NDQ65_08145) | 1576861..1577136 | - | 276 | WP_003695501.1 | hypothetical protein | - |
| NDQ65_RS08205 (NDQ65_08150) | 1577289..1577621 | - | 333 | WP_003695500.1 | hypothetical protein | - |
| NDQ65_RS08210 (NDQ65_08155) | 1577762..1577962 | - | 201 | WP_003695499.1 | hypothetical protein | - |
| NDQ65_RS08215 (NDQ65_08160) | 1578203..1578619 | - | 417 | WP_003693479.1 | hypothetical protein | - |
| NDQ65_RS08220 (NDQ65_08165) | 1578628..1579212 | - | 585 | WP_003693477.1 | Panacea domain-containing protein | - |
| NDQ65_RS08225 (NDQ65_08170) | 1579395..1579796 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NDQ65_RS08230 (NDQ65_08175) | 1579898..1580080 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NDQ65_RS08235 (NDQ65_08180) | 1580250..1581080 | - | 831 | WP_228841286.1 | DUF3037 domain-containing protein | - |
| NDQ65_RS08240 (NDQ65_08185) | 1581341..1582096 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| NDQ65_RS08245 (NDQ65_08190) | 1582233..1582418 | + | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| NDQ65_RS08250 (NDQ65_08195) | 1582507..1582662 | + | 156 | WP_003703527.1 | hypothetical protein | - |
| NDQ65_RS08255 (NDQ65_08200) | 1582639..1582827 | - | 189 | WP_003706568.1 | hypothetical protein | - |
| NDQ65_RS08260 (NDQ65_08205) | 1583000..1583227 | + | 228 | WP_033910869.1 | helix-turn-helix domain-containing protein | - |
| NDQ65_RS08265 (NDQ65_08210) | 1583224..1584234 | + | 1011 | WP_082298581.1 | helix-turn-helix domain-containing protein | - |
| NDQ65_RS08270 (NDQ65_08215) | 1584248..1585027 | + | 780 | WP_025455898.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1564642..1597065 | 32423 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T247731 WP_003689143.1 NZ_CP098538:c1580080-1579898 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT247731 WP_003691454.1 NZ_CP098538:c1579796-1579395 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|