Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 650929..651584 | Replicon | chromosome |
Accession | NZ_CP098538 | ||
Organism | Neisseria gonorrhoeae strain ATCC 49226 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | NDQ65_RS03490 | Protein ID | WP_003691083.1 |
Coordinates | 651165..651584 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | NDQ65_RS03485 | Protein ID | WP_003688410.1 |
Coordinates | 650929..651165 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDQ65_RS03455 (NDQ65_03450) | 646062..646349 | + | 288 | WP_025455945.1 | hypothetical protein | - |
NDQ65_RS03460 (NDQ65_03455) | 646421..647587 | + | 1167 | WP_003701280.1 | ADP-forming succinate--CoA ligase subunit beta | - |
NDQ65_RS03465 (NDQ65_03460) | 647598..648488 | + | 891 | WP_003693285.1 | succinate--CoA ligase subunit alpha | - |
NDQ65_RS03470 (NDQ65_03465) | 648871..649257 | - | 387 | Protein_677 | transposase | - |
NDQ65_RS03475 (NDQ65_03470) | 649496..649897 | + | 402 | WP_020997337.1 | helix-turn-helix domain-containing protein | - |
NDQ65_RS03480 (NDQ65_03475) | 649902..650723 | + | 822 | WP_010358440.1 | IS3 family transposase | - |
NDQ65_RS03485 (NDQ65_03480) | 650929..651165 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
NDQ65_RS03490 (NDQ65_03485) | 651165..651584 | + | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
NDQ65_RS03495 (NDQ65_03490) | 651733..653187 | - | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
NDQ65_RS03500 (NDQ65_03495) | 653184..653885 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
NDQ65_RS03505 (NDQ65_03500) | 653882..654661 | - | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
NDQ65_RS03510 (NDQ65_03505) | 654809..656350 | + | 1542 | WP_003701286.1 | MDR family MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 648805..649278 | 473 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T247730 WP_003691083.1 NZ_CP098538:651165-651584 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|