Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1630422..1631107 | Replicon | chromosome |
| Accession | NZ_CP098536 | ||
| Organism | Neisseria gonorrhoeae strain 10771 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | NDQ63_RS08435 | Protein ID | WP_003689143.1 |
| Coordinates | 1630925..1631107 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | NDQ63_RS08430 | Protein ID | WP_003691454.1 |
| Coordinates | 1630422..1630823 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDQ63_RS08385 (NDQ63_08325) | 1625840..1626022 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| NDQ63_RS08390 (NDQ63_08330) | 1626162..1626848 | - | 687 | WP_010357532.1 | hypothetical protein | - |
| NDQ63_RS08395 (NDQ63_08335) | 1626917..1627078 | - | 162 | WP_003691530.1 | hypothetical protein | - |
| NDQ63_RS08400 (NDQ63_08340) | 1627075..1627350 | - | 276 | WP_033911205.1 | hypothetical protein | - |
| NDQ63_RS08405 (NDQ63_08345) | 1627503..1627835 | - | 333 | WP_003695500.1 | hypothetical protein | - |
| NDQ63_RS08410 (NDQ63_08350) | 1627976..1628140 | - | 165 | WP_003700376.1 | hypothetical protein | - |
| NDQ63_RS08415 (NDQ63_08355) | 1628381..1629142 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| NDQ63_RS08420 (NDQ63_08360) | 1629231..1629647 | - | 417 | WP_003700378.1 | hypothetical protein | - |
| NDQ63_RS08425 (NDQ63_08365) | 1629656..1630240 | - | 585 | WP_003693477.1 | Panacea domain-containing protein | - |
| NDQ63_RS08430 (NDQ63_08370) | 1630422..1630823 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NDQ63_RS08435 (NDQ63_08375) | 1630925..1631107 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NDQ63_RS08440 (NDQ63_08380) | 1631277..1632095 | - | 819 | WP_003693474.1 | DUF3037 domain-containing protein | - |
| NDQ63_RS08445 (NDQ63_08385) | 1632370..1633125 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| NDQ63_RS08450 (NDQ63_08390) | 1633262..1633447 | + | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| NDQ63_RS08455 (NDQ63_08395) | 1633536..1633691 | + | 156 | WP_003698902.1 | hypothetical protein | - |
| NDQ63_RS08460 (NDQ63_08400) | 1633668..1633856 | - | 189 | WP_003691445.1 | hypothetical protein | - |
| NDQ63_RS08465 (NDQ63_08405) | 1634029..1634256 | + | 228 | WP_003705596.1 | helix-turn-helix domain-containing protein | - |
| NDQ63_RS08470 (NDQ63_08410) | 1634253..1634765 | + | 513 | WP_033911191.1 | helix-turn-helix domain-containing protein | - |
| NDQ63_RS08475 (NDQ63_08415) | 1634779..1635297 | + | 519 | WP_025456213.1 | hypothetical protein | - |
| NDQ63_RS08480 (NDQ63_08420) | 1635312..1636091 | + | 780 | WP_025455898.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1614857..1648147 | 33290 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T247728 WP_003689143.1 NZ_CP098536:c1631107-1630925 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT247728 WP_003691454.1 NZ_CP098536:c1630823-1630422 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|