Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 950710..951365 | Replicon | chromosome |
Accession | NZ_CP098536 | ||
Organism | Neisseria gonorrhoeae strain 10771 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | NDQ63_RS04895 | Protein ID | WP_003691083.1 |
Coordinates | 950710..951129 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | NDQ63_RS04900 | Protein ID | WP_003688410.1 |
Coordinates | 951129..951365 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDQ63_RS04875 (NDQ63_04840) | 945944..947485 | - | 1542 | WP_003691084.1 | MDR family MFS transporter | - |
NDQ63_RS04880 (NDQ63_04845) | 947633..948412 | + | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
NDQ63_RS04885 (NDQ63_04850) | 948409..949110 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
NDQ63_RS04890 (NDQ63_04855) | 949107..950561 | + | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
NDQ63_RS04895 (NDQ63_04860) | 950710..951129 | - | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
NDQ63_RS04900 (NDQ63_04865) | 951129..951365 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
NDQ63_RS04905 (NDQ63_04870) | 951812..952390 | - | 579 | WP_003697246.1 | IS3 family transposase | - |
NDQ63_RS04910 (NDQ63_04875) | 952395..952685 | - | 291 | WP_047917062.1 | helix-turn-helix domain-containing protein | - |
NDQ63_RS04915 (NDQ63_04880) | 953035..953421 | + | 387 | Protein_965 | transposase | - |
NDQ63_RS04920 (NDQ63_04885) | 953804..954694 | - | 891 | WP_003693285.1 | succinate--CoA ligase subunit alpha | - |
NDQ63_RS04925 (NDQ63_04890) | 954705..955871 | - | 1167 | WP_003699872.1 | ADP-forming succinate--CoA ligase subunit beta | - |
NDQ63_RS04930 (NDQ63_04895) | 955943..956230 | - | 288 | WP_003688407.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T247727 WP_003691083.1 NZ_CP098536:c951129-950710 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|