Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1206888..1207573 Replicon chromosome
Accession NZ_CP098534
Organism Neisseria gonorrhoeae strain 10525

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag NDQ70_RS06365 Protein ID WP_003689143.1
Coordinates 1206888..1207070 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag NDQ70_RS06370 Protein ID WP_003691454.1
Coordinates 1207172..1207573 (+) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NDQ70_RS06330 (NDQ70_03275) 1201894..1202793 - 900 WP_041421306.1 replication protein -
NDQ70_RS06335 (NDQ70_03270) 1202990..1203190 - 201 WP_012503750.1 hypothetical protein -
NDQ70_RS06340 (NDQ70_03265) 1203192..1203326 - 135 WP_229684436.1 YdaS family helix-turn-helix protein -
NDQ70_RS06345 (NDQ70_03260) 1203542..1204228 + 687 WP_012503751.1 helix-turn-helix transcriptional regulator -
NDQ70_RS06350 (NDQ70_03255) 1204268..1204966 + 699 WP_002212401.1 S24 family peptidase -
NDQ70_RS06355 (NDQ70_03250) 1205205..1205903 + 699 WP_003689139.1 hypothetical protein -
NDQ70_RS06360 (NDQ70_03245) 1205900..1206718 + 819 WP_012503752.1 DUF3037 domain-containing protein -
NDQ70_RS06365 (NDQ70_03240) 1206888..1207070 + 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
NDQ70_RS06370 (NDQ70_03235) 1207172..1207573 + 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NDQ70_RS06375 (NDQ70_03230) 1207672..1208433 - 762 WP_012503753.1 hypothetical protein -
NDQ70_RS06380 (NDQ70_03225) 1208654..1208854 + 201 WP_003704298.1 hypothetical protein -
NDQ70_RS06385 (NDQ70_03220) 1208887..1209363 + 477 WP_012504141.1 hypothetical protein -
NDQ70_RS06390 (NDQ70_11830) 1209360..1209647 + 288 WP_263589020.1 hypothetical protein -
NDQ70_RS06395 (NDQ70_03215) 1209788..1210120 + 333 WP_003687946.1 hypothetical protein -
NDQ70_RS06400 (NDQ70_03210) 1210273..1210551 + 279 WP_003691529.1 hypothetical protein -
NDQ70_RS06405 (NDQ70_03205) 1210548..1210709 + 162 WP_003702497.1 hypothetical protein -
NDQ70_RS06410 (NDQ70_03200) 1210778..1211464 + 687 WP_012503754.1 hypothetical protein -
NDQ70_RS06415 (NDQ70_03195) 1211604..1211786 + 183 WP_003691535.1 hypothetical protein -
NDQ70_RS06420 (NDQ70_03190) 1211783..1212274 + 492 WP_003691537.1 siphovirus Gp157 family protein -
NDQ70_RS06425 (NDQ70_03185) 1212326..1212541 + 216 WP_003691538.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1168274..1228703 60429


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T247726 WP_003689143.1 NZ_CP098534:1206888-1207070 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT247726 WP_003691454.1 NZ_CP098534:1207172-1207573 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References