Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 723171..723826 | Replicon | chromosome |
Accession | NZ_CP098534 | ||
Organism | Neisseria gonorrhoeae strain 10525 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | NDQ70_RS03875 | Protein ID | WP_003691083.1 |
Coordinates | 723407..723826 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | NDQ70_RS03870 | Protein ID | WP_003688410.1 |
Coordinates | 723171..723407 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDQ70_RS03840 (NDQ70_05715) | 718305..718592 | + | 288 | WP_003688407.1 | hypothetical protein | - |
NDQ70_RS03845 (NDQ70_05710) | 718664..719830 | + | 1167 | WP_003688408.1 | ADP-forming succinate--CoA ligase subunit beta | - |
NDQ70_RS03850 (NDQ70_05705) | 719841..720731 | + | 891 | WP_002244992.1 | succinate--CoA ligase subunit alpha | - |
NDQ70_RS03855 (NDQ70_05700) | 721114..721500 | - | 387 | Protein_748 | transposase | - |
NDQ70_RS03860 (NDQ70_05695) | 721739..722140 | + | 402 | WP_020997339.1 | helix-turn-helix domain-containing protein | - |
NDQ70_RS03865 (NDQ70_05690) | 722145..722723 | + | 579 | WP_003688041.1 | IS3 family transposase | - |
NDQ70_RS03870 (NDQ70_05685) | 723171..723407 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
NDQ70_RS03875 (NDQ70_05680) | 723407..723826 | + | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
NDQ70_RS03880 (NDQ70_05675) | 723975..725429 | - | 1455 | WP_003701282.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
NDQ70_RS03885 (NDQ70_05670) | 725426..726127 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
NDQ70_RS03890 (NDQ70_05665) | 726124..726903 | - | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
NDQ70_RS03895 (NDQ70_05660) | 727051..728592 | + | 1542 | WP_003697015.1 | MDR family MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T247725 WP_003691083.1 NZ_CP098534:723407-723826 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|