Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1207727..1208412 Replicon chromosome
Accession NZ_CP098532
Organism Neisseria gonorrhoeae strain 10537

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag NDQ66_RS06385 Protein ID WP_003689143.1
Coordinates 1207727..1207909 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag NDQ66_RS06390 Protein ID WP_003691454.1
Coordinates 1208011..1208412 (+) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NDQ66_RS06350 (NDQ66_06300) 1202733..1203632 - 900 WP_041421306.1 replication protein -
NDQ66_RS06355 (NDQ66_06305) 1203829..1204029 - 201 WP_012503750.1 hypothetical protein -
NDQ66_RS06360 (NDQ66_06310) 1204031..1204165 - 135 WP_229684436.1 YdaS family helix-turn-helix protein -
NDQ66_RS06365 (NDQ66_06315) 1204381..1205067 + 687 WP_012503751.1 helix-turn-helix transcriptional regulator -
NDQ66_RS06370 (NDQ66_06320) 1205107..1205805 + 699 WP_002212401.1 S24 family peptidase -
NDQ66_RS06375 (NDQ66_06325) 1206044..1206742 + 699 WP_003689139.1 hypothetical protein -
NDQ66_RS06380 (NDQ66_06330) 1206739..1207557 + 819 WP_012503752.1 DUF3037 domain-containing protein -
NDQ66_RS06385 (NDQ66_06335) 1207727..1207909 + 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
NDQ66_RS06390 (NDQ66_06340) 1208011..1208412 + 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NDQ66_RS06395 (NDQ66_06345) 1208511..1209272 - 762 WP_012503753.1 hypothetical protein -
NDQ66_RS06400 (NDQ66_06350) 1209493..1209693 + 201 WP_003704298.1 hypothetical protein -
NDQ66_RS06405 (NDQ66_06355) 1209726..1210202 + 477 WP_012504141.1 hypothetical protein -
NDQ66_RS06410 (NDQ66_06360) 1210199..1210486 + 288 WP_071236956.1 hypothetical protein -
NDQ66_RS06415 (NDQ66_06365) 1210627..1210959 + 333 WP_003687946.1 hypothetical protein -
NDQ66_RS06420 (NDQ66_06370) 1211112..1211390 + 279 WP_003691529.1 hypothetical protein -
NDQ66_RS06425 (NDQ66_06375) 1211387..1211548 + 162 WP_003702497.1 hypothetical protein -
NDQ66_RS06430 (NDQ66_06380) 1211617..1212303 + 687 WP_012503754.1 hypothetical protein -
NDQ66_RS06435 (NDQ66_06385) 1212443..1212625 + 183 WP_003691535.1 hypothetical protein -
NDQ66_RS06440 (NDQ66_06390) 1212622..1213113 + 492 WP_003691537.1 siphovirus Gp157 family protein -
NDQ66_RS06445 (NDQ66_06395) 1213165..1213380 + 216 WP_003691538.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1169113..1229540 60427


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T247724 WP_003689143.1 NZ_CP098532:1207727-1207909 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT247724 WP_003691454.1 NZ_CP098532:1208011-1208412 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References