Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 724016..724671 | Replicon | chromosome |
Accession | NZ_CP098532 | ||
Organism | Neisseria gonorrhoeae strain 10537 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | NDQ66_RS03895 | Protein ID | WP_003691083.1 |
Coordinates | 724252..724671 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | NDQ66_RS03890 | Protein ID | WP_003688410.1 |
Coordinates | 724016..724252 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDQ66_RS03860 (NDQ66_03840) | 719150..719437 | + | 288 | WP_003688407.1 | hypothetical protein | - |
NDQ66_RS03865 (NDQ66_03845) | 719509..720675 | + | 1167 | WP_003688408.1 | ADP-forming succinate--CoA ligase subunit beta | - |
NDQ66_RS03870 (NDQ66_03850) | 720686..721576 | + | 891 | WP_002244992.1 | succinate--CoA ligase subunit alpha | - |
NDQ66_RS03875 (NDQ66_03855) | 721959..722345 | - | 387 | Protein_752 | transposase | - |
NDQ66_RS03880 (NDQ66_03860) | 722584..722985 | + | 402 | WP_020997339.1 | helix-turn-helix domain-containing protein | - |
NDQ66_RS03885 (NDQ66_03865) | 722990..723568 | + | 579 | WP_003688041.1 | IS3 family transposase | - |
NDQ66_RS03890 (NDQ66_03870) | 724016..724252 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
NDQ66_RS03895 (NDQ66_03875) | 724252..724671 | + | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
NDQ66_RS03900 (NDQ66_03880) | 724820..726274 | - | 1455 | WP_003701282.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
NDQ66_RS03905 (NDQ66_03885) | 726271..726972 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
NDQ66_RS03910 (NDQ66_03890) | 726969..727748 | - | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
NDQ66_RS03915 (NDQ66_03895) | 727896..729437 | + | 1542 | WP_003697015.1 | MDR family MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T247723 WP_003691083.1 NZ_CP098532:724252-724671 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|