Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 3312595..3313273 | Replicon | chromosome |
| Accession | NZ_CP098521 | ||
| Organism | Acinetobacter baumannii strain Cl107 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NDN18_RS15920 | Protein ID | WP_000009390.1 |
| Coordinates | 3312595..3312774 (+) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A009Q2Y3 |
| Locus tag | NDN18_RS15925 | Protein ID | WP_032058837.1 |
| Coordinates | 3312860..3313273 (+) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDN18_RS15900 (NDN18_15895) | 3308401..3309261 | - | 861 | WP_196085344.1 | GPO family capsid scaffolding protein | - |
| NDN18_RS15905 (NDN18_15900) | 3309440..3311218 | + | 1779 | WP_196085343.1 | terminase family protein | - |
| NDN18_RS15910 (NDN18_15905) | 3311215..3312261 | + | 1047 | WP_254231395.1 | phage portal protein | - |
| NDN18_RS15915 (NDN18_15910) | 3312272..3312487 | + | 216 | WP_227552920.1 | hypothetical protein | - |
| NDN18_RS15920 (NDN18_15915) | 3312595..3312774 | + | 180 | WP_000009390.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NDN18_RS15925 (NDN18_15920) | 3312860..3313273 | + | 414 | WP_032058837.1 | antitoxin | Antitoxin |
| NDN18_RS15930 (NDN18_15925) | 3313533..3314051 | - | 519 | WP_031945607.1 | hypothetical protein | - |
| NDN18_RS15955 (NDN18_15950) | 3315244..3316308 | - | 1065 | WP_001278262.1 | quinolinate synthase NadA | - |
| NDN18_RS15960 (NDN18_15955) | 3316455..3317675 | - | 1221 | WP_000268125.1 | bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3270384..3313273 | 42889 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6799.11 Da Isoelectric Point: 11.1422
>T247721 WP_000009390.1 NZ_CP098521:3312595-3312774 [Acinetobacter baumannii]
MSFNEFKRWLIAQGVIFVRKGKGSHMIIEFNGKKTVFPNHGKKEIPEGTRLKIKKDLGL
MSFNEFKRWLIAQGVIFVRKGKGSHMIIEFNGKKTVFPNHGKKEIPEGTRLKIKKDLGL
Download Length: 180 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15334.70 Da Isoelectric Point: 6.2451
>AT247721 WP_032058837.1 NZ_CP098521:3312860-3313273 [Acinetobacter baumannii]
MKCYVSIHREGEAFIVSSSELPELNSVGYTLEEALSEALDGIETVFEIYMDERKAIPLPSKGKKGEYAVHLPVRVAAKVR
LYNEMISQNVTKAELARRLGWLQKQADRLLSLKHSTKLESIESAFQALGKDLDIVIA
MKCYVSIHREGEAFIVSSSELPELNSVGYTLEEALSEALDGIETVFEIYMDERKAIPLPSKGKKGEYAVHLPVRVAAKVR
LYNEMISQNVTKAELARRLGWLQKQADRLLSLKHSTKLESIESAFQALGKDLDIVIA
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|