Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 457782..458435 | Replicon | chromosome |
Accession | NZ_CP098521 | ||
Organism | Acinetobacter baumannii strain Cl107 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A3R9G864 |
Locus tag | NDN18_RS02265 | Protein ID | WP_000607075.1 |
Coordinates | 458046..458435 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | NDN18_RS02260 | Protein ID | WP_001288210.1 |
Coordinates | 457782..458039 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDN18_RS02240 (NDN18_02240) | 453298..454305 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
NDN18_RS02245 (NDN18_02245) | 454324..454701 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
NDN18_RS02250 (NDN18_02250) | 454883..456373 | + | 1491 | WP_000415123.1 | NAD(P)/FAD-dependent oxidoreductase | - |
NDN18_RS02255 (NDN18_02255) | 456422..457594 | - | 1173 | WP_001190556.1 | acyl-CoA dehydrogenase family protein | - |
NDN18_RS02260 (NDN18_02260) | 457782..458039 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
NDN18_RS02265 (NDN18_02265) | 458046..458435 | + | 390 | WP_000607075.1 | membrane protein | Toxin |
NDN18_RS02270 (NDN18_02270) | 459205..460290 | + | 1086 | WP_000049105.1 | hypothetical protein | - |
NDN18_RS02275 (NDN18_02275) | 460368..460934 | + | 567 | WP_000651539.1 | rhombosortase | - |
NDN18_RS02280 (NDN18_02280) | 461122..463317 | + | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15649.94 Da Isoelectric Point: 10.3890
>T247720 WP_000607075.1 NZ_CP098521:458046-458435 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKVIDYQIFIVIYFEGHKTLTSIIWFDQMSLVEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKVIDYQIFIVIYFEGHKTLTSIIWFDQMSLVEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3R9G864 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BQM7 |