Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 1366294..1366882 | Replicon | chromosome |
Accession | NZ_CP098511 | ||
Organism | Aquimarina sp. ERC-38 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | NBT05_RS05855 | Protein ID | WP_265772556.1 |
Coordinates | 1366294..1366596 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NBT05_RS05860 | Protein ID | WP_265772557.1 |
Coordinates | 1366598..1366882 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBT05_RS05830 (NBT05_05825) | 1361565..1362599 | - | 1035 | WP_265772551.1 | ferrochelatase | - |
NBT05_RS05835 (NBT05_05830) | 1362817..1362987 | + | 171 | WP_265772552.1 | hypothetical protein | - |
NBT05_RS05840 (NBT05_05835) | 1362995..1363885 | - | 891 | WP_265772553.1 | AraC family transcriptional regulator | - |
NBT05_RS05845 (NBT05_05840) | 1364070..1365320 | + | 1251 | WP_265772554.1 | glutamyl-tRNA reductase | - |
NBT05_RS05850 (NBT05_05845) | 1365322..1366236 | + | 915 | WP_265772555.1 | hydroxymethylbilane synthase | - |
NBT05_RS05855 (NBT05_05850) | 1366294..1366596 | + | 303 | WP_265772556.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBT05_RS05860 (NBT05_05855) | 1366598..1366882 | + | 285 | WP_265772557.1 | putative addiction module antidote protein | Antitoxin |
NBT05_RS05865 (NBT05_05860) | 1367039..1367641 | + | 603 | WP_265772558.1 | uroporphyrinogen-III synthase | - |
NBT05_RS05870 (NBT05_05865) | 1367664..1368689 | + | 1026 | WP_265772560.1 | uroporphyrinogen decarboxylase | - |
NBT05_RS05875 (NBT05_05870) | 1368759..1369181 | + | 423 | WP_265772561.1 | hypothetical protein | - |
NBT05_RS05880 (NBT05_05875) | 1369218..1370123 | + | 906 | WP_265772562.1 | oxygen-dependent coproporphyrinogen oxidase | - |
NBT05_RS05885 (NBT05_05880) | 1370375..1370995 | + | 621 | WP_265772563.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 12053.14 Da Isoelectric Point: 10.5404
>T247718 WP_265772556.1 NZ_CP098511:1366294-1366596 [Aquimarina sp. ERC-38]
MFFIEKTKEFNKWFRKLKDSKAKTKILYRIQRLENDEHFGDCKPVGDGIKEIRINFAKEYRIYFKEKNGRIIILLIGGDK
STQQKDIKKAKEIWNKLNNL
MFFIEKTKEFNKWFRKLKDSKAKTKILYRIQRLENDEHFGDCKPVGDGIKEIRINFAKEYRIYFKEKNGRIIILLIGGDK
STQQKDIKKAKEIWNKLNNL
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|