Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF-MazE |
| Location | 51877..52454 | Replicon | plasmid pLM58-55 |
| Accession | NZ_CP098508 | ||
| Organism | Listeria monocytogenes strain L58-55 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | H1G8D6 |
| Locus tag | BES38_RS15205 | Protein ID | WP_003728465.1 |
| Coordinates | 52113..52454 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | H1G8D5 |
| Locus tag | BES38_RS15200 | Protein ID | WP_003728464.1 |
| Coordinates | 51877..52119 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BES38_RS15175 (BES38_15170) | 49403..49651 | - | 249 | WP_009911232.1 | hypothetical protein | - |
| BES38_RS15180 (BES38_15175) | 50050..50427 | - | 378 | WP_003769263.1 | DUF3850 domain-containing protein | - |
| BES38_RS15185 (BES38_15180) | 50446..51108 | - | 663 | WP_003731676.1 | DUF2786 domain-containing protein | - |
| BES38_RS15190 (BES38_15185) | 51108..51434 | - | 327 | WP_031641563.1 | hypothetical protein | - |
| BES38_RS15195 (BES38_15190) | 51580..51816 | + | 237 | WP_003769265.1 | hypothetical protein | - |
| BES38_RS15200 (BES38_15195) | 51877..52119 | + | 243 | WP_003728464.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| BES38_RS15205 (BES38_15200) | 52113..52454 | + | 342 | WP_003728465.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| BES38_RS15210 (BES38_15205) | 52480..52623 | - | 144 | WP_157105793.1 | hypothetical protein | - |
| BES38_RS15215 (BES38_15210) | 52677..53648 | - | 972 | WP_031641941.1 | hypothetical protein | - |
| BES38_RS15220 (BES38_15215) | 53652..53906 | - | 255 | WP_031641560.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | ClpL | - | 1..61167 | 61167 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12827.74 Da Isoelectric Point: 9.2830
>T247717 WP_003728465.1 NZ_CP098508:52113-52454 [Listeria monocytogenes]
MVKQGDIIKINLNPKQGHEQQGYRPYICLSHHLVSDYANIAIFAPISNTPRTYPLYVPLTGTTTTGKVLLDQLVTIDYNA
RKHQYVETVSDPLLTKLLDTVKVIFQKNERSTN
MVKQGDIIKINLNPKQGHEQQGYRPYICLSHHLVSDYANIAIFAPISNTPRTYPLYVPLTGTTTTGKVLLDQLVTIDYNA
RKHQYVETVSDPLLTKLLDTVKVIFQKNERSTN
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|