Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 723788..724443 | Replicon | chromosome |
Accession | NZ_CP098505 | ||
Organism | Neisseria gonorrhoeae strain 10536 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | NDL72_RS03890 | Protein ID | WP_003691083.1 |
Coordinates | 724024..724443 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | NDL72_RS03885 | Protein ID | WP_003688410.1 |
Coordinates | 723788..724024 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDL72_RS03855 (NDL72_03820) | 718922..719209 | + | 288 | WP_003688407.1 | hypothetical protein | - |
NDL72_RS03860 (NDL72_03825) | 719281..720447 | + | 1167 | WP_003688408.1 | ADP-forming succinate--CoA ligase subunit beta | - |
NDL72_RS03865 (NDL72_03830) | 720458..721348 | + | 891 | WP_002244992.1 | succinate--CoA ligase subunit alpha | - |
NDL72_RS03870 (NDL72_03835) | 721731..722117 | - | 387 | Protein_752 | transposase | - |
NDL72_RS03875 (NDL72_03840) | 722467..722757 | + | 291 | WP_041420764.1 | helix-turn-helix domain-containing protein | - |
NDL72_RS03880 (NDL72_03845) | 722762..723340 | + | 579 | WP_003688041.1 | IS3 family transposase | - |
NDL72_RS03885 (NDL72_03850) | 723788..724024 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
NDL72_RS03890 (NDL72_03855) | 724024..724443 | + | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
NDL72_RS03895 (NDL72_03860) | 724592..726046 | - | 1455 | WP_003701282.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
NDL72_RS03900 (NDL72_03865) | 726043..726744 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
NDL72_RS03905 (NDL72_03870) | 726741..727520 | - | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
NDL72_RS03910 (NDL72_03875) | 727668..729209 | + | 1542 | WP_003697015.1 | MDR family MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T247715 WP_003691083.1 NZ_CP098505:724024-724443 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|