Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1168722..1169407 | Replicon | chromosome |
| Accession | NZ_CP098503 | ||
| Organism | Neisseria gonorrhoeae strain 10268 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | NDL73_RS06050 | Protein ID | WP_003689143.1 |
| Coordinates | 1169225..1169407 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | NDL73_RS06045 | Protein ID | WP_003691454.1 |
| Coordinates | 1168722..1169123 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDL73_RS06000 (NDL73_08395) | 1164140..1164322 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| NDL73_RS06005 (NDL73_08400) | 1164462..1165148 | - | 687 | WP_010357532.1 | hypothetical protein | - |
| NDL73_RS06010 (NDL73_08405) | 1165217..1165378 | - | 162 | WP_003691530.1 | hypothetical protein | - |
| NDL73_RS06015 (NDL73_08410) | 1165375..1165650 | - | 276 | WP_033911205.1 | hypothetical protein | - |
| NDL73_RS06020 (NDL73_08415) | 1165803..1166135 | - | 333 | WP_003695500.1 | hypothetical protein | - |
| NDL73_RS06025 (NDL73_08420) | 1166276..1166440 | - | 165 | WP_003700376.1 | hypothetical protein | - |
| NDL73_RS06030 (NDL73_08425) | 1166681..1167442 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| NDL73_RS06035 (NDL73_08430) | 1167531..1167947 | - | 417 | WP_003700378.1 | hypothetical protein | - |
| NDL73_RS06040 (NDL73_08435) | 1167956..1168540 | - | 585 | WP_003693477.1 | Panacea domain-containing protein | - |
| NDL73_RS06045 (NDL73_08440) | 1168722..1169123 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NDL73_RS06050 (NDL73_08445) | 1169225..1169407 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NDL73_RS06055 (NDL73_08450) | 1169577..1170395 | - | 819 | WP_003693474.1 | DUF3037 domain-containing protein | - |
| NDL73_RS06060 (NDL73_08455) | 1170670..1171425 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| NDL73_RS06065 (NDL73_08460) | 1171562..1171747 | + | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| NDL73_RS06070 (NDL73_08465) | 1171836..1171991 | + | 156 | WP_003698902.1 | hypothetical protein | - |
| NDL73_RS06075 (NDL73_08470) | 1171968..1172156 | - | 189 | WP_003691445.1 | hypothetical protein | - |
| NDL73_RS06080 (NDL73_08475) | 1172329..1172556 | + | 228 | WP_003705596.1 | helix-turn-helix domain-containing protein | - |
| NDL73_RS06085 (NDL73_08480) | 1172553..1173020 | + | 468 | WP_229433445.1 | helix-turn-helix domain-containing protein | - |
| NDL73_RS06090 (NDL73_08485) | 1173034..1173564 | + | 531 | WP_229931507.1 | hypothetical protein | - |
| NDL73_RS06095 (NDL73_08490) | 1173579..1174358 | + | 780 | WP_025455898.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1153157..1186469 | 33312 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T247714 WP_003689143.1 NZ_CP098503:c1169407-1169225 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT247714 WP_003691454.1 NZ_CP098503:c1169123-1168722 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|