Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2585965..2586497 | Replicon | chromosome |
Accession | NZ_CP098502 | ||
Organism | Paraconexibacter antarcticus strain 02-257 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NBH00_RS12830 | Protein ID | WP_254568991.1 |
Coordinates | 2586198..2586497 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NBH00_RS12825 | Protein ID | WP_254568990.1 |
Coordinates | 2585965..2586198 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBH00_RS12790 (NBH00_12790) | 2581258..2581593 | + | 336 | WP_254568983.1 | hypothetical protein | - |
NBH00_RS12795 (NBH00_12795) | 2581567..2581815 | - | 249 | WP_254568984.1 | hypothetical protein | - |
NBH00_RS12800 (NBH00_12800) | 2581997..2582392 | + | 396 | WP_254568985.1 | hypothetical protein | - |
NBH00_RS12805 (NBH00_12805) | 2582389..2582757 | + | 369 | WP_254568986.1 | hypothetical protein | - |
NBH00_RS12810 (NBH00_12810) | 2582754..2583107 | + | 354 | WP_254568987.1 | NFACT family protein | - |
NBH00_RS12815 (NBH00_12815) | 2583107..2584447 | + | 1341 | WP_254568988.1 | site-specific integrase | - |
NBH00_RS12820 (NBH00_12820) | 2584474..2585880 | + | 1407 | WP_254568989.1 | site-specific integrase | - |
NBH00_RS12825 (NBH00_12825) | 2585965..2586198 | + | 234 | WP_254568990.1 | hypothetical protein | Antitoxin |
NBH00_RS12830 (NBH00_12830) | 2586198..2586497 | + | 300 | WP_254568991.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NBH00_RS12835 (NBH00_12835) | 2587379..2589265 | - | 1887 | WP_254568992.1 | MFS transporter | - |
NBH00_RS12840 (NBH00_12840) | 2589398..2589880 | - | 483 | WP_254568993.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 10515.28 Da Isoelectric Point: 7.1663
>T247712 WP_254568991.1 NZ_CP098502:2586198-2586497 [Paraconexibacter antarcticus]
MRPIHIARLDKTRPVLVLTRELVRAHLRSVTVAPITTTIRGLSTEVPVGPPNGLSGPSVVSCDNITTIPVAALGQQTGVL
LDRQEPALAEAIAMAFDLE
MRPIHIARLDKTRPVLVLTRELVRAHLRSVTVAPITTTIRGLSTEVPVGPPNGLSGPSVVSCDNITTIPVAALGQQTGVL
LDRQEPALAEAIAMAFDLE
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|