Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1831106..1831721 | Replicon | chromosome |
Accession | NZ_CP098500 | ||
Organism | Serratia symbiotica strain Pl-LLN |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | M5J15_RS09965 | Protein ID | WP_252747415.1 |
Coordinates | 1831106..1831474 (-) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | M5J15_RS09970 | Protein ID | WP_252749167.1 |
Coordinates | 1831455..1831721 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5J15_RS09930 (M5J15_09875) | 1826341..1826640 | + | 300 | Protein_1979 | ATP-binding protein | - |
M5J15_RS09935 (M5J15_09880) | 1826799..1827083 | + | 285 | WP_252747412.1 | hypothetical protein | - |
M5J15_RS09940 (M5J15_09885) | 1827128..1827283 | + | 156 | WP_252747413.1 | DUF3164 family protein | - |
M5J15_RS09945 (M5J15_09890) | 1827305..1828512 | - | 1208 | Protein_1982 | IS256 family transposase | - |
M5J15_RS09950 (M5J15_09895) | 1828594..1829478 | + | 885 | WP_284700538.1 | acyltransferase | - |
M5J15_RS09955 (M5J15_09900) | 1829805..1830565 | + | 761 | Protein_1984 | DNA adenine methylase | - |
M5J15_RS09960 (M5J15_09905) | 1830673..1830921 | + | 249 | Protein_1985 | flavodoxin FldB | - |
M5J15_RS09965 (M5J15_09910) | 1831106..1831474 | - | 369 | WP_252747415.1 | protein YgfX | Toxin |
M5J15_RS09970 (M5J15_09915) | 1831455..1831721 | - | 267 | WP_252749167.1 | FAD assembly factor SdhE | Antitoxin |
M5J15_RS09975 (M5J15_09920) | 1832054..1833040 | + | 987 | WP_252747416.1 | tRNA-modifying protein YgfZ | - |
M5J15_RS09980 (M5J15_09925) | 1833321..1833995 | - | 675 | WP_252747417.1 | hemolysin III family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 14796.37 Da Isoelectric Point: 9.9146
>T247711 WP_252747415.1 NZ_CP098500:c1831474-1831106 [Serratia symbiotica]
VAQWRCDVRISRCTQLFSLLTHGVLVLLILLLFQGIRSQKRLAAVRGELRLLADWRINWHGREWRLVKKPWMPDYGILLT
LHPMEGNKYQRLWLVLDNMEREEWRYLRQRLLYPPVSDDEET
VAQWRCDVRISRCTQLFSLLTHGVLVLLILLLFQGIRSQKRLAAVRGELRLLADWRINWHGREWRLVKKPWMPDYGILLT
LHPMEGNKYQRLWLVLDNMEREEWRYLRQRLLYPPVSDDEET
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|