Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 471788..472411 | Replicon | chromosome |
Accession | NZ_CP098500 | ||
Organism | Serratia symbiotica strain Pl-LLN |
Toxin (Protein)
Gene name | Hha | Uniprot ID | E9CPA8 |
Locus tag | M5J15_RS02500 | Protein ID | WP_006709525.1 |
Coordinates | 471788..471991 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | M5J15_RS02505 | Protein ID | WP_252748422.1 |
Coordinates | 472043..472411 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5J15_RS02480 (M5J15_02475) | 468064..469836 | + | 1773 | WP_252748420.1 | SmdB family multidrug efflux ABC transporter permease/ATP-binding protein | - |
M5J15_RS02485 (M5J15_02480) | 470077..470415 | + | 339 | WP_252748421.1 | P-II family nitrogen regulator | - |
M5J15_RS02490 (M5J15_02485) | 470661..470903 | - | 243 | Protein_492 | methylated-DNA--[protein]-cysteine S-methyltransferase | - |
M5J15_RS02500 (M5J15_02495) | 471788..471991 | - | 204 | WP_006709525.1 | HHA domain-containing protein | Toxin |
M5J15_RS02505 (M5J15_02500) | 472043..472411 | - | 369 | WP_252748422.1 | Hha toxicity modulator TomB | Antitoxin |
M5J15_RS02510 (M5J15_02505) | 472927..474006 | - | 1080 | Protein_495 | ISAs1 family transposase | - |
M5J15_RS02515 (M5J15_02510) | 474273..474446 | - | 174 | WP_252748423.1 | hypothetical protein | - |
M5J15_RS02520 (M5J15_02515) | 474432..475145 | + | 714 | WP_252748424.1 | ABC transporter ATP-binding protein | - |
M5J15_RS02525 (M5J15_02520) | 475142..475999 | + | 858 | WP_252748425.1 | metal ABC transporter permease | - |
M5J15_RS02530 (M5J15_02525) | 476027..476908 | + | 882 | WP_252748426.1 | metal ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8090.38 Da Isoelectric Point: 7.9816
>T247710 WP_006709525.1 NZ_CP098500:c471991-471788 [Serratia symbiotica]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSNDELELFYSAADHRLAELTMNKLYDKIPTAVWKYVR
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSNDELELFYSAADHRLAELTMNKLYDKIPTAVWKYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14191.98 Da Isoelectric Point: 4.3135
>AT247710 WP_252748422.1 NZ_CP098500:c472411-472043 [Serratia symbiotica]
MDEYSSKRHDIAQLKFLCENLYDEGIATLDDSCHGWVNDPTSFVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DNAYMLFSGYGINDSDLRRWQKTTAKLFRMFSGEGICTTMKT
MDEYSSKRHDIAQLKFLCENLYDEGIATLDDSCHGWVNDPTSFVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DNAYMLFSGYGINDSDLRRWQKTTAKLFRMFSGEGICTTMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|