Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 164281..164915 | Replicon | chromosome |
| Accession | NZ_CP098500 | ||
| Organism | Serratia symbiotica strain Pl-LLN | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | M5J15_RS00920 | Protein ID | WP_040266910.1 |
| Coordinates | 164739..164915 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | M5J15_RS00915 | Protein ID | WP_252748217.1 |
| Coordinates | 164281..164688 (-) | Length | 136 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5J15_RS00880 (M5J15_00880) | 159620..160489 | - | 870 | WP_252748212.1 | IS21-like element helper ATPase IstB | - |
| M5J15_RS00885 (M5J15_00885) | 160486..161513 | - | 1028 | Protein_176 | IS21 family transposase | - |
| M5J15_RS00890 (M5J15_00890) | 161684..162313 | + | 630 | WP_252748213.1 | ATP-binding protein | - |
| M5J15_RS00895 (M5J15_00895) | 162303..163016 | - | 714 | WP_252748214.1 | hypothetical protein | - |
| M5J15_RS00900 (M5J15_00900) | 163077..163418 | - | 342 | Protein_179 | lysis protein | - |
| M5J15_RS00905 (M5J15_00905) | 163595..163957 | - | 363 | WP_252748216.1 | structural protein | - |
| M5J15_RS00910 (M5J15_00910) | 163944..164203 | - | 260 | Protein_181 | phage holin, lambda family | - |
| M5J15_RS00915 (M5J15_00915) | 164281..164688 | - | 408 | WP_252748217.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| M5J15_RS00920 (M5J15_00920) | 164739..164915 | - | 177 | WP_040266910.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| M5J15_RS00925 (M5J15_00925) | 165061..165765 | - | 705 | Protein_184 | IS6 family transposase | - |
| M5J15_RS00930 (M5J15_00930) | 165865..166731 | - | 867 | WP_252748218.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD | - |
| M5J15_RS00940 (M5J15_00940) | 167369..167728 | - | 360 | Protein_186 | DUF4942 domain-containing protein | - |
| M5J15_RS00945 (M5J15_00945) | 167791..168495 | + | 705 | Protein_187 | IS6 family transposase | - |
| M5J15_RS00950 (M5J15_00950) | 168694..169394 | + | 701 | Protein_188 | LuxR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 158623..168189 | 9566 | |
| - | inside | IScluster/Tn | - | - | 155679..170675 | 14996 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6619.79 Da Isoelectric Point: 11.1475
>T247709 WP_040266910.1 NZ_CP098500:c164915-164739 [Serratia symbiotica]
VKQSEFRRWLAAQGAEFKDGTNHLKIILNSKQTVMPRHPGKEIPEPLRKAILKQLGIT
VKQSEFRRWLAAQGAEFKDGTNHLKIILNSKQTVMPRHPGKEIPEPLRKAILKQLGIT
Download Length: 177 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14784.92 Da Isoelectric Point: 4.6363
>AT247709 WP_252748217.1 NZ_CP098500:c164688-164281 [Serratia symbiotica]
MRYPVKFEHDETGWCVSFPGIPEALTGGDTREEAIEMAQDALVTAFDFYFEDRRPVPMPSADGEEFIDVPASVAAKVLLL
NAMIATGTTPAQLARRLGTRPQEVNRIVTLNHATKIDTIEAALKALGKRLEITAV
MRYPVKFEHDETGWCVSFPGIPEALTGGDTREEAIEMAQDALVTAFDFYFEDRRPVPMPSADGEEFIDVPASVAAKVLLL
NAMIATGTTPAQLARRLGTRPQEVNRIVTLNHATKIDTIEAALKALGKRLEITAV
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|