Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 124562..125172 | Replicon | chromosome |
Accession | NZ_CP098500 | ||
Organism | Serratia symbiotica strain Pl-LLN |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | M5J15_RS00700 | Protein ID | WP_252748197.1 |
Coordinates | 124562..124741 (+) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | M5J15_RS00705 | Protein ID | WP_252748198.1 |
Coordinates | 124762..125172 (+) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5J15_RS00685 (M5J15_00685) | 120117..120713 | - | 597 | WP_252748194.1 | deoxyribose-phosphate aldolase | - |
M5J15_RS00690 (M5J15_00690) | 121411..122181 | - | 771 | WP_252748195.1 | TatD family hydrolase | - |
M5J15_RS00695 (M5J15_00695) | 122765..124354 | - | 1590 | WP_252748196.1 | peptide chain release factor 3 | - |
M5J15_RS00700 (M5J15_00700) | 124562..124741 | + | 180 | WP_252748197.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
M5J15_RS00705 (M5J15_00705) | 124762..125172 | + | 411 | WP_252748198.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
M5J15_RS00710 (M5J15_00710) | 125292..125855 | - | 564 | WP_284700490.1 | Ig-like domain-containing protein | - |
M5J15_RS00715 (M5J15_00715) | 126303..126747 | - | 445 | Protein_143 | ribosomal protein S18-alanine N-acetyltransferase | - |
M5J15_RS00720 (M5J15_00720) | 126692..127129 | - | 438 | WP_252748200.1 | DNA polymerase III subunit psi | - |
M5J15_RS00725 (M5J15_00725) | 127276..128322 | + | 1047 | WP_252748201.1 | 16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC | - |
M5J15_RS00735 (M5J15_00735) | 129251..129298 | + | 48 | Protein_146 | hypothetical protein | - |
M5J15_RS00740 (M5J15_00740) | 129743..130031 | - | 289 | Protein_147 | integrase core domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6672.91 Da Isoelectric Point: 10.9132
>T247708 WP_252748197.1 NZ_CP098500:124562-124741 [Serratia symbiotica]
MGSRNAIVMIEADGWYLVRVKGSHHQFKHPTKKGLVTVKHPQKDIPLPTLKSIKKQEGL
MGSRNAIVMIEADGWYLVRVKGSHHQFKHPTKKGLVTVKHPQKDIPLPTLKSIKKQEGL
Download Length: 180 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14814.89 Da Isoelectric Point: 4.3299
>AT247708 WP_252748198.1 NZ_CP098500:124762-125172 [Serratia symbiotica]
MLYPVAIDKGDSSFGVRVPDIPGCFSGGDNYQDAIESVREAIDAHIELLMEDGEAVPEATSVENWLADPDYAGVVWALVD
VDVIRLMGKAEKINVTLPSLLIRRIDQFVAAHPEYGSRSGFLSRLAADKVIGRVKI
MLYPVAIDKGDSSFGVRVPDIPGCFSGGDNYQDAIESVREAIDAHIELLMEDGEAVPEATSVENWLADPDYAGVVWALVD
VDVIRLMGKAEKINVTLPSLLIRRIDQFVAAHPEYGSRSGFLSRLAADKVIGRVKI
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|