Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 26823..27589 | Replicon | chromosome |
Accession | NZ_CP098500 | ||
Organism | Serratia symbiotica strain Pl-LLN |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | M5J15_RS00200 | Protein ID | WP_252748134.1 |
Coordinates | 27221..27589 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | M5J15_RS00195 | Protein ID | WP_252748133.1 |
Coordinates | 26823..27158 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5J15_RS00165 (M5J15_00165) | 22180..23208 | - | 1029 | WP_252748129.1 | IS21 family transposase | - |
M5J15_RS00170 (M5J15_00170) | 23378..24142 | + | 765 | Protein_33 | IS21-like element helper ATPase IstB | - |
M5J15_RS00175 (M5J15_00175) | 24226..24687 | + | 462 | WP_252748130.1 | hypothetical protein | - |
M5J15_RS00180 (M5J15_00180) | 24934..25496 | + | 563 | Protein_35 | hypothetical protein | - |
M5J15_RS00185 (M5J15_00185) | 25497..26066 | + | 570 | WP_252748131.1 | hypothetical protein | - |
M5J15_RS00190 (M5J15_00190) | 26328..26807 | + | 480 | WP_252748132.1 | DNA repair protein RadC | - |
M5J15_RS00195 (M5J15_00195) | 26823..27158 | + | 336 | WP_252748133.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M5J15_RS00200 (M5J15_00200) | 27221..27589 | + | 369 | WP_252748134.1 | TA system toxin CbtA family protein | Toxin |
M5J15_RS00205 (M5J15_00205) | 27793..28340 | - | 548 | Protein_40 | DDE-type integrase/transposase/recombinase | - |
M5J15_RS00210 (M5J15_00210) | 28553..29335 | - | 783 | WP_252748135.1 | reverse transcriptase domain-containing protein | - |
M5J15_RS00215 (M5J15_00215) | 29350..29778 | - | 429 | WP_252748136.1 | reverse transcriptase domain-containing protein | - |
M5J15_RS00220 (M5J15_00220) | 30381..30641 | - | 261 | WP_252748137.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 106..64179 | 64073 | |
- | inside | IScluster/Tn | - | - | 20239..28217 | 7978 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13706.67 Da Isoelectric Point: 5.6193
>T247705 WP_252748134.1 NZ_CP098500:27221-27589 [Serratia symbiotica]
MQTLPVTPKRAAYACPSPVVVWQSMLTYLLEQHYGLALNDTEFSDDAVIHEHIDAGISLADALNFTVEKFDLVRTDRRGF
SCEEQSPFITAIDILRARRATGLMVRMGYQSITSVIRGEKQT
MQTLPVTPKRAAYACPSPVVVWQSMLTYLLEQHYGLALNDTEFSDDAVIHEHIDAGISLADALNFTVEKFDLVRTDRRGF
SCEEQSPFITAIDILRARRATGLMVRMGYQSITSVIRGEKQT
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|