Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1354942..1355858 | Replicon | chromosome |
Accession | NZ_CP098491 | ||
Organism | Bacillus subtilis strain NB205 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | NDK36_RS07205 | Protein ID | WP_003244695.1 |
Coordinates | 1355112..1355858 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | NDK36_RS07200 | Protein ID | WP_003232646.1 |
Coordinates | 1354942..1355112 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDK36_RS07165 (NDK36_07165) | 1351801..1352130 | + | 330 | WP_014479562.1 | XkdW family protein | - |
NDK36_RS07170 (NDK36_07170) | 1352127..1352291 | + | 165 | WP_014479563.1 | XkdX family protein | - |
NDK36_RS07175 (NDK36_07175) | 1352338..1353177 | + | 840 | WP_014479564.1 | phage-like element PBSX protein XepA | - |
NDK36_RS07180 (NDK36_07180) | 1353230..1353499 | + | 270 | WP_014479565.1 | hemolysin XhlA family protein | - |
NDK36_RS07185 (NDK36_07185) | 1353512..1353775 | + | 264 | WP_014479566.1 | phage holin | - |
NDK36_RS07190 (NDK36_07190) | 1353788..1354681 | + | 894 | WP_014479567.1 | N-acetylmuramoyl-L-alanine amidase | - |
NDK36_RS07195 (NDK36_07195) | 1354719..1354856 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
NDK36_RS07200 (NDK36_07200) | 1354942..1355112 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
NDK36_RS07205 (NDK36_07205) | 1355112..1355858 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
NDK36_RS07210 (NDK36_07210) | 1355968..1356969 | - | 1002 | WP_014479569.1 | inorganic phosphate transporter | - |
NDK36_RS07215 (NDK36_07215) | 1356982..1357599 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
NDK36_RS07220 (NDK36_07220) | 1357875..1359191 | - | 1317 | WP_014479570.1 | serine/threonine exchanger | - |
NDK36_RS07225 (NDK36_07225) | 1359580..1360530 | + | 951 | WP_014479571.1 | ring-cleaving dioxygenase | - |
NDK36_RS07230 (NDK36_07230) | 1360639..1360734 | + | 96 | Protein_1365 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T247704 WP_003244695.1 NZ_CP098491:c1355858-1355112 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|