Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 503835..504471 | Replicon | chromosome |
| Accession | NZ_CP098491 | ||
| Organism | Bacillus subtilis strain NB205 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | NDK36_RS02600 | Protein ID | WP_003156187.1 |
| Coordinates | 504121..504471 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G4NU32 |
| Locus tag | NDK36_RS02595 | Protein ID | WP_003225183.1 |
| Coordinates | 503835..504116 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDK36_RS02575 (NDK36_02575) | 500194..500793 | - | 600 | WP_014478896.1 | rhomboid family intramembrane serine protease | - |
| NDK36_RS02580 (NDK36_02580) | 500888..501253 | + | 366 | WP_014478897.1 | holo-ACP synthase | - |
| NDK36_RS02585 (NDK36_02585) | 501419..502435 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
| NDK36_RS02590 (NDK36_02590) | 502550..503719 | + | 1170 | WP_014478898.1 | alanine racemase | - |
| NDK36_RS02595 (NDK36_02595) | 503835..504116 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| NDK36_RS02600 (NDK36_02600) | 504121..504471 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| NDK36_RS02605 (NDK36_02605) | 504587..505411 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
| NDK36_RS02610 (NDK36_02610) | 505416..505781 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
| NDK36_RS02615 (NDK36_02615) | 505785..506186 | + | 402 | WP_014478899.1 | serine/threonine-protein kinase RsbT | - |
| NDK36_RS02620 (NDK36_02620) | 506198..507205 | + | 1008 | WP_014478900.1 | phosphoserine phosphatase RsbU | - |
| NDK36_RS02625 (NDK36_02625) | 507274..507603 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
| NDK36_RS02630 (NDK36_02630) | 507600..508082 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
| NDK36_RS02635 (NDK36_02635) | 508048..508836 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
| NDK36_RS02640 (NDK36_02640) | 508836..509435 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T247703 WP_003156187.1 NZ_CP098491:504121-504471 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|