Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2276556..2277295 | Replicon | chromosome |
| Accession | NZ_CP098486 | ||
| Organism | Enterobacter hormaechei subsp. hormaechei strain ECC33 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A3S0FZ61 |
| Locus tag | NDJ97_RS11025 | Protein ID | WP_022648141.1 |
| Coordinates | 2276556..2277041 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A837FCR9 |
| Locus tag | NDJ97_RS11030 | Protein ID | WP_003857131.1 |
| Coordinates | 2277029..2277295 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDJ97_RS11000 (NDJ97_11000) | 2272712..2273734 | + | 1023 | WP_022648135.1 | alpha/beta hydrolase | - |
| NDJ97_RS11005 (NDJ97_11005) | 2273830..2274594 | + | 765 | WP_022648136.1 | SDR family oxidoreductase | - |
| NDJ97_RS11010 (NDJ97_11010) | 2275261..2275524 | + | 264 | WP_022648138.1 | DUF4225 domain-containing protein | - |
| NDJ97_RS11015 (NDJ97_11015) | 2275499..2275828 | - | 330 | WP_022648139.1 | hypothetical protein | - |
| NDJ97_RS11020 (NDJ97_11020) | 2275961..2276530 | + | 570 | WP_022648140.1 | hypothetical protein | - |
| NDJ97_RS11025 (NDJ97_11025) | 2276556..2277041 | - | 486 | WP_022648141.1 | GNAT family N-acetyltransferase | Toxin |
| NDJ97_RS11030 (NDJ97_11030) | 2277029..2277295 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
| NDJ97_RS11035 (NDJ97_11035) | 2277359..2278288 | - | 930 | WP_022648142.1 | LysR family transcriptional regulator | - |
| NDJ97_RS11040 (NDJ97_11040) | 2278418..2279806 | + | 1389 | WP_022648143.1 | MFS transporter | - |
| NDJ97_RS11045 (NDJ97_11045) | 2279785..2280342 | - | 558 | WP_022648144.1 | OmpH family outer membrane protein | - |
| NDJ97_RS11050 (NDJ97_11050) | 2280463..2281599 | - | 1137 | WP_022648145.1 | type 1 fimbrial protein | - |
| NDJ97_RS11055 (NDJ97_11055) | 2281623..2282201 | - | 579 | WP_022648146.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2253689..2280342 | 26653 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17558.24 Da Isoelectric Point: 9.6275
>T247694 WP_022648141.1 NZ_CP098486:c2277041-2276556 [Enterobacter hormaechei subsp. hormaechei]
VGRVTPPEPLSSVHQLAEFISGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDVSIRGNGLGADLLQDAVLRCYRVAENIGVRAIMVHALTEDAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTPPEPLSSVHQLAEFISGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDVSIRGNGLGADLLQDAVLRCYRVAENIGVRAIMVHALTEDAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S0FZ61 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FCR9 |